KEGG   Streptomyces coelicolor: SCO2126Help
Entry
SCO2126           CDS       T00085                                 

Gene name
glk, SC6E10.20c
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00052  Galactose metabolism
sco00500  Starch and sucrose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco00521  Streptomycin biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO2126 (glk)
   00052 Galactose metabolism
    SCO2126 (glk)
   00500 Starch and sucrose metabolism
    SCO2126 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO2126 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCO2126 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SCO2126 (glk)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCO2126 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Hydant_A_N FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-GeneID: 1097560
NCBI-ProteinID: NP_626383
Kitasato: SCO2126
UniProt: P0A4E1
Position
complement(2285983..2286936)
Genome map
AA seq 317 aa AA seqDB search
MGLTIGVDIGGTKIAAGVVDEEGNILSTHKVPTPTTPEAIVDAIASAVEGARVGHEIVAV
GIGAAGYVNRQRSTVYFAPNIDWRQEPLKEKVEARVGLPVVVENDANAAAWGEYKFGGGK
GHRNVICITLGTGLGGGIIIGNKLRRGHFGVAAEFGHIRMVPDGLLCGCGSQGCWEQYAS
GRALVRYAKQRANATPERAEVLLALGDGTPDGIEGKHISVAARQGCPVAVDSYRELARWA
GAGLADLASLFDPSAFIVGGGLSDEGDLVLDPIRKSYKRWLVGGNWRPVADVIAAQLGNK
AGLVGAADLAREPDPIM
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccatcggcgtcgacatcggcggcacgaagatcgcggccggcgtggtcgac
gaggaaggcaacatcctctcgacccacaaggtgccgacccccaccacacccgaggccatc
gtggacgccatcgcctccgcggtcgagggggcgcgagtggggcacgagatcgtcgcagtg
ggcatcggcgccgccggatacgtcaaccgccagcgctccacggtctacttcgcgcccaac
atcgactggcgccaggagccgctcaaggagaaggtcgaggcccgcgtcggcctcccggtc
gtcgtggagaacgacgccaacgccgcggcctggggcgagtacaagttcggcggcggcaag
ggccaccgcaacgtcatctgcatcaccctcggcaccggcctcggcggcggcatcatcatc
ggcaacaagctgcgccgcggccacttcggcgtggccgcggagttcggccacatccgcatg
gtgccggacggcctgctgtgcggctgcggctcgcagggctgctgggagcagtacgcgtcg
gggcgggcgctggtgaggtacgccaagcagcgcgccaacgccacccccgagcgcgccgag
gtgctgctcgccctcggcgacggcacccccgacggcatcgagggcaagcacatctcggtc
gccgcccgccagggctgcccggtcgccgtcgactcctaccgggagctggcccgctgggcc
ggggccggtctcgccgacctggcctcgctcttcgacccgtccgccttcatcgtcggcggc
ggcctctcggacgagggcgacctggtcctcgacccgatccgcaagtcctacaagcgctgg
ctggtcggcggcaactggcgcccggtcgccgacgtgatcgccgcccaactcggcaacaag
gccggcctggtcggcgccgccgacctggcgagagaacccgacccgatcatgtga

DBGET integrated database retrieval system