KEGG   Streptomyces coelicolor: SCO2145Help
Entry
SCO2145           CDS       T00085                                 

Gene name
SC6G10.18
Definition
(RefSeq) glycerate kinase
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00561  Glycerolipid metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2145 (SC6G10.18)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SCO2145 (SC6G10.18)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2145 (SC6G10.18)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     SCO2145 (SC6G10.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_kinase
Motif
Other DBs
NCBI-GeneID: 1097579
NCBI-ProteinID: NP_626401
Kitasato: SCO2145
UniProt: Q9X804
Position
2305901..2307199
Genome map
AA seq 432 aa AA seqDB search
MSHPSPVLNRVVVAPSGFKESLSARAAADAIAAGVRRVLPDAEIDRIPLVDGGEGTAVAL
ASATGGRLVALAATGPVGDRVGTHFALLGTGDTAVVEMAAVAGLSLVPRALRDPGATTTY
GVGELIRAALGTGVRRVLVGCGDSGTSDGGAGALQALGARLLDGDGFELGPGGRELNRLV
RVDPSGLDARLKDTELLVACNPYNVLCGERGVARVFGPQKGATPAQVEELSAGLENWARV
LTRDLGVVGTDLRTGSGTGASGGLGAGLAAVGARLLPRFDVLLGHLDLDARLARADLVLT
AEGALDHQTPRGKVPAEVARRAKLSGRPVLALAGTLGEGAHDVPGVDACHGIMPAPMALA
DALLRASELLTDATERALRMVLLGARLPAGPAQAAVPVTGAVPRDAGSPDAWSPDAVSPD
AGSGTQRPSSVR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatccgtcccccgtgctgaaccgagtggtcgtggcccccagcggattcaaggag
tccctgtccgcccgcgccgccgccgacgccatcgcggcgggcgtccgccgggtgctgccg
gacgccgagatcgaccggatcccgctcgtggacggcggcgagggcaccgccgtcgcgctg
gcgtccgcgaccggcgggcggctggtggcgctggccgccaccggtccggtcggcgaccgg
gtcggcacccacttcgcgctgctcggcaccggggacacggcggtggtggagatggcggcc
gtcgcgggcctgtccctggtcccccgcgctctgcgcgaccccggcgccaccaccacgtac
ggcgtcggcgagctgatccgcgccgctctcggcaccggggtgcggcgcgtgctggtcggc
tgcggcgactcggggacgtccgacgggggcgcgggcgcgctccaggcgctcggggcccgg
ctgctggacggggacggcttcgaactcggacccggcggacgggagctgaaccgcctcgtc
cgcgtcgacccgtccggcctcgacgcccggctgaaggacaccgagctgctcgtcgcctgc
aacccctacaacgtgctgtgcggcgagcggggcgtggcccgggtgttcggcccgcagaag
ggggcgacgcccgcgcaggtcgaggagttgtcggccgggctggagaactgggcgcgcgtg
ctcacccgcgacctcggcgtcgtcggcaccgacctgcgcacggggtccggcaccggcgcg
tccggcggtctcggcgcgggactcgccgccgtcggggcccggctgctgccccgcttcgac
gtgctcctgggccacctcgacctggacgcccgcctcgcccgggccgacctggtgctcacc
gccgagggagccctggaccaccagacgccgcgcggcaaggtgccggccgaggtggcccgc
cgcgccaagctctccggcaggcccgtcctcgccctggcgggcacgctcggcgagggcgcg
cacgacgtgcccggggtggacgcctgccacgggatcatgccggcgccgatggccctggcg
gacgcgttgctgcgcgcctccgagctcctcacggacgccacggaacgggcgctgcggatg
gtgctgctgggggcccggttgccggccgggccggctcaggcggcggtgccggtcaccggt
gccgtcccgcgggacgccgggtcgccggacgcgtggtcgccggacgccgtgtcgccggac
gccgggtcgggcacgcagcggccgtcctcggtgcggtag

DBGET integrated database retrieval system