KEGG   Streptomyces coelicolor: SCO2147Help
Entry
SCO2147           CDS       T00085                                 

Gene name
trpD
Definition
(RefSeq) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
sco  Streptomyces coelicolor
Pathway
sco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCO2147 (trpD)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     SCO2147 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N Moricin
Motif
Other DBs
NCBI-GeneID: 1097581
NCBI-ProteinID: NP_626403
Kitasato: SCO2147
UniProt: O68608
Position
complement(2308851..2309915)
Genome map
AA seq 354 aa AA seqDB search
MSAVTPAGGDTTADRSWPALLNGLLDGRDLSADDTAWALDVIMRGEATDVQIAGFAVGLR
FKGETVEEISGLVRTMYEHANVIEVPGKTVDIVGTGGDGAKTVNISTMSAIVLAGTGAKV
VKHGNRAASSASGASDVLEKLGVNLELTPQRVAEVAEEAGITFCFAVKFHPALRHVATAR
GQLGIRTVFNFLGPLTNPARVKAQAVGVAHARMAPIVAGVFAERGHSSLVFRGDDGLDEL
TTTSTSRVWVVRDGRVTEETFDPRDVGIELVPVEALRGADASYNADVARRLLAGEKGPVR
DAVLLNSAAALEALEPGEGALAERLRAGMDRAAEAIDSGAARRVLERWVAVSHA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgtgacccccgctggaggcgacaccacggcggaccgctcctggcccgccctg
ctgaacggactgctggacggccgcgacctgagcgcggacgacaccgcctgggcgctggac
gtgatcatgcgcggcgaggcgaccgacgtgcagatcgccgggttcgcggtgggcctgcgg
ttcaagggggagacggtcgaggagatctccggactggtccgcaccatgtacgaacacgcc
aacgtgatcgaggtgccggggaagaccgtcgacatcgtcggcaccggcggcgacggcgcc
aagacggtcaacatctccaccatgtcggcgatcgtcctggccggcacgggggcgaaggtc
gtcaagcacggcaaccgggccgcctcctcggcgtccggggcctccgacgtcctggagaag
ctcggggtcaacctggagctgacgccgcagcgggtggcggaggtcgccgaggaagccggc
atcaccttctgcttcgccgtgaagttccacccggcgctgcgccacgtggcgacggcccgc
ggtcagctcggcatccgtacggtgttcaacttcctgggtccgctgaccaaccccgcccgg
gtgaaggcccaggcggtcggggtcgcccacgcccggatggcgccgatcgtcgccggtgtc
ttcgccgagcgcggccactcgtccctggtcttccgcggcgacgacggactcgacgagctg
accacgacctccacctcccgggtctgggtcgtgcgcgacggccgggtgaccgaggagacc
ttcgacccgcgcgacgtcggcatcgagctggtgccggtcgaggcgctgcgcggggccgac
gcctcctacaacgccgacgtcgcccgccgcctgctggccggcgagaagggtccggtgcgg
gacgcggtcctgctgaactcggcggcggccctggaggccctggagcccggcgagggggcg
ctggccgagcggctgcgggccgggatggaccgggcggccgaggcgatcgactccggggcg
gcccggcgggtgctggagcgctgggtggccgtgagccacgcgtag

DBGET integrated database retrieval system