KEGG   Streptomyces coelicolor: SCO2162Help
Entry
SCO2162           CDS       T00085                                 

Gene name
SC6G10.35
Definition
(RefSeq) quinolinate synthetase
  KO
K03517  quinolinate synthase [EC:2.5.1.72]
Organism
sco  Streptomyces coelicolor
Pathway
sco00760  Nicotinate and nicotinamide metabolism
sco01100  Metabolic pathways
Module
sco_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO2162 (SC6G10.35)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     SCO2162 (SC6G10.35)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NadA
Motif
Other DBs
NCBI-GeneID: 1097596
NCBI-ProteinID: NP_733560
Kitasato: SCO2162
UniProt: Q9F364
Position
2325064..2326248
Genome map
AA seq 394 aa AA seqDB search
MTTAQTQELDVQPTPLALLLLGREADPRSERGVECPGDLPSPSDPDLVARARAAKEKLGD
KVFVLGHHYQRDEVIQFADVTGDSFKLARDAAARPEAEYIVFCGVHFMAESADILTSNDQ
KVVLPDLAAGCSMADMATAEQVAECWDVLTEAGIAEQVVPVSYMNSSADIKAFTGKHGGT
ICTSSNAERALNWAFEQGEKVLFLPDQHLGRNTAVRDLGMSLEDCVVYNPHRPNGGLTAK
ELRDANMILWRGHCSVHGRFSLDSVNDVRERIPGVNVLVHPECKHEVVAAADYVGSTEYI
IKALEAAPAGSKWAIGTELNLVRRLANRFAAEDKEIVFLDKTVCFCSTMNRIDLPHLVWT
LESLAEGTLVNRIEVDQETEAFAKLALERMLALP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgcccaaacccaggagctcgacgtacagccgacgcccctcgccctgctgctg
ctcggccgcgaggccgacccgaggagcgagcgcggtgtggagtgtcccggtgacctgccc
tcgccctccgacccggacctggtcgcacgcgcccgtgcggccaaggagaagctcggtgac
aaggtcttcgtgctcggtcaccactaccagcgcgacgaggtcatccagttcgccgatgtc
acgggcgactccttcaagctggcccgggacgcggcggcgcgcccggaggccgagtacatc
gtcttctgcggtgtgcacttcatggcggagtcggccgacatcctgacctcgaacgaccag
aaggtggtcctgcccgacctggcggccgggtgctccatggccgacatggccacggccgag
caggtcgccgaatgctgggacgtgctgaccgaggccgggatcgccgagcaggtcgtgccc
gtgtcgtacatgaactcgtcggcggacatcaaggcgttcaccggcaagcacggcggcacc
atctgcacctcctccaacgccgagcgcgccctgaactgggcgttcgagcagggcgagaag
gtcctcttcctgcccgaccagcacctgggccgcaacacggcggtgcgggacctgggcatg
tccctggaggactgcgtcgtctacaacccgcaccggccgaacggcgggctgacggcgaag
gagctgcgcgacgcgaacatgatcctgtggcggggtcactgctcggtgcacggccgcttc
agcctcgactcggtcaacgacgtgcgcgagcgcataccgggcgtgaacgtcctggtgcac
ccggagtgcaagcacgaggtcgtcgcggcggcggactacgtcggctcgaccgagtacatc
atcaaggccctggaggcggccccggccggttccaagtgggccatcggcaccgagctgaac
ctggtccgccgcctggcgaaccgtttcgccgccgaggacaaggagatcgtcttcctcgac
aagacggtctgcttctgctcgaccatgaaccgcatcgacctcccccacctggtctggacg
ctggagtccctcgccgagggcaccctggtcaaccgcatcgaggtggaccaggagacggag
gccttcgccaagctggcgctggagcggatgctggcgctgccgtag

DBGET integrated database retrieval system