KEGG   Streptomyces coelicolor: SCO2181Help
Entry
SCO2181           CDS       T00085                                 

Gene name
SC5F7.20, sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00310  Lysine degradation
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO2181 (SC5F7.20)
  09105 Amino acid metabolism
   00310 Lysine degradation
    SCO2181 (SC5F7.20)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SCO2181 (SC5F7.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H HlyD_3
Motif
Other DBs
NCBI-GeneID: 1097614
NCBI-ProteinID: NP_626434
Kitasato: SCO2181
UniProt: Q9S2Q5
Position
2345796..2347568
Genome map
AA seq 590 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPASGVLSSIK
VAEDETVEVGAELALIDDGSGAPAAAPAPQAEQVAEPAPEPAPAAPSTEQAAPAPAPTAD
AAAGGSAQGTDVVLPALGESVTEGTVTRWLKSVGDSVEEDEPLLEVSTDKVDTEIPAPAS
GTLLEIVVGEDETAEVGAKLAVIGAAGAAPAAAPAAPAAPAQEAPAAPAQPEPTPAPAPA
QAAPAPAPQAPAAPAPQPAAPAPAPAPAAAPAAPAAAQPVDDGAYVTPLVRKLAAENGVD
LSTVKGTGVGGRIRKQDVAAAAEAAKAAAPAPAAAPAAPAAKKAPVLEASPLRGQTVKMP
RIRKVIGDNMVKALHEQAQLSSVVEVDVTRLMKLRARAKDAFAAREGVKLSPMPFFVKAA
AQALKAHAPVNAKINEAEGTITYFDTENIGIAVDSEKGLMTPVIKNAGDLNLAGIAKATA
DLAGKVRASKISPDELAGATFTISNTGSRGALFDTIIVPPGQVAILGIGATVKRPAVIET
EDGPVIGVRDMTYLTLSYDHRLVDGADAARYLTAVKAILEAGEFEVELGL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcaccgtcacc
cgctggctgaaggccgagggtgagcgcgtcgaggccgacgagccgttgctcgaggtctcg
accgacaaggtcgacaccgagatcccggcccccgcctcgggcgtgctgtcctccatcaag
gtcgccgaggacgagaccgtcgaggtcggcgccgagctggcgctgatcgacgacggcagc
ggcgcccccgccgccgccccggccccgcaggccgagcaggtcgccgagccggcccccgag
cccgccccggccgccccttccaccgagcaggccgccccggcgcccgctcccaccgccgac
gccgccgccggcggctccgcgcagggcacggacgtggtcctgcccgcgctcggcgagtcc
gtcaccgagggcaccgtcacccgctggctgaagtcggtcggtgacagcgtcgaggaggac
gagccgctgctcgaggtctcgaccgacaaggtcgacaccgagatcccggcccccgcctcc
ggcaccctgctggagatcgtggtcggcgaggacgagacggccgaggtcggcgccaagctc
gccgtcatcggtgcggcgggtgccgccccggcggctgccccggccgcccccgcggccccg
gcccaggaggccccggccgccccggcccagcccgagcccaccccggccccggctcccgcg
caggccgctccggctccggccccgcaggcgccggcggctccggccccgcagcccgccgct
ccggcgcccgcaccggccccggccgccgctccggctgccccggccgccgcccagccggtg
gacgacggcgcctacgtcaccccgctggtgcgcaagctcgccgccgagaacggcgtcgac
ctgtccaccgtcaagggcaccggcgtcggcggccgcatccgcaagcaggacgtcgccgcc
gccgccgaggccgcgaaggccgccgccccggctccggccgccgcccccgccgcgcccgcc
gcgaagaaggcccccgtcctggaggcctccccgctgcgtggccagaccgtcaagatgccg
cgcatccgcaaggtcatcggcgacaacatggtcaaggcgctgcacgagcaggcccagctg
tcgtcggtcgtcgaggtcgacgtcacccgtctgatgaagctgcgcgcccgtgccaaggac
gcgttcgcggcgcgcgagggcgtcaagctctccccgatgccgttcttcgtcaaggccgcg
gcccaggccctcaaggcccacgccccggtcaacgccaagatcaacgaggccgaggggacc
atcacctacttcgacaccgagaacatcggtatcgcggtggactccgagaagggcctgatg
accccggtcatcaagaacgccggtgacctgaacctggccggcatcgccaaggcgaccgcc
gacctggcgggcaaggtgcgggccagcaagatcagcccggacgagctggccggtgcgacc
ttcaccatcagcaacaccggttcgcgcggcgcgctgttcgacacgatcatcgtgccgccg
ggccaggtcgccatcctcggcatcggtgccacggtcaagcgtccggccgtcatcgagacg
gaggacggcccggtcatcggcgtccgcgacatgacgtacctgaccctgtcctacgaccac
cgtctggtggacggcgccgacgccgcccgctacctgacggcggtcaaggcgatcctggag
gcgggcgagttcgaggtcgagctcggcctgtag

DBGET integrated database retrieval system