KEGG   Streptomyces coelicolor: SCO2228Help
Entry
SCO2228           CDS       T00085                                 

Gene name
aglA, SC10B7.23c
Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
sco  Streptomyces coelicolor
Pathway
sco00052  Galactose metabolism
sco00500  Starch and sucrose metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SCO2228 (aglA)
   00500 Starch and sucrose metabolism
    SCO2228 (aglA)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SCO2228 (aglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459
Motif
Other DBs
NCBI-GeneID: 1097661
NCBI-ProteinID: NP_626479
Kitasato: SCO2228
UniProt: Q9KZ09
Position
complement(2395074..2396807)
Genome map
AA seq 577 aa AA seqDB search
MSQQPSAAPAPTSAVATVSERHDWWRDAVIYQVYPRSFADSNGDGMGDLEGVRTRLPYLR
DLGVDAVWLSPFYASPQADAGYDVADYRAVDPMFGTLLDADALIRDAHALGLRIIVDLVP
NHSSDQYEWFKRALAEGPGSPSRDRYHFRPGKGKNGELPPNDWESIFGGPAWTRVTEPDG
TPGEWYLHLFAPEQPDFNWEHPAVGDEFRSILRFWLDMGVDGFRIDVAHGMVKAEGLPDL
GSHEQLKLLGNDVMPFFDQDGVHEIYRQWRRILDEYSDAMGPEGPSAEGRGRVTGGRIFV
AEAWTPTVERTANYVRPDELHQAFNFQYLGTHWDAEELRTVIDRTLDAMRPVGAPATWVL
SNHDVTRHATRFANPAGLGTQIRLAGDRALGLRRARAATLLMLALPGSAYVYQGEELGLP
DVVDLPDEVRQDPAYFRGAGQDGFRDGCRVPIPWTREGSSYGFGDGGSWLPQPAGWGELS
VEAQTGEPGSTLELYREALAVRRSTADLGAGDAVEWLRAPEGVVAFRRGDFVCVANTTGE
SVAVPAHGRVLLASGEITEAAGEAKVPADTTVWWTRA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagccttccgccgcaccggcccccacctccgccgtcgccaccgtctccgag
cgccacgactggtggcgggacgcggtcatctaccaggtgtacccgcgcagcttcgccgac
agcaacggcgacggcatgggcgacctggagggtgtccgcacccgcctgccgtacctgcgc
gacctgggcgtggacgccgtgtggctcagccccttctacgcctccccgcaggccgacgcc
ggttacgacgtcgccgactaccgggccgtcgaccccatgttcggcaccctcctggacgcc
gacgcgctgatccgcgacgcccacgcgctgggcctgcgcatcatcgtcgacctggtgccc
aaccactcctccgaccagtacgagtggttcaagcgcgcgctggccgagggccccggctcc
ccttcccgggaccgctaccacttccgccccggcaaggggaagaacggcgaactgccgccc
aacgactgggagtccatcttcggcggccccgcctggacccgggtcaccgagcccgacggc
acgccgggggagtggtacctgcacctgttcgcccccgagcagcccgacttcaactgggag
cacccggccgtcggcgacgagttccgctccatcctgcggttctggctggacatgggcgtg
gacggcttccgcatcgacgtcgcccacggcatggtcaaggcggagggcctgcccgacctc
ggatcccacgagcagctgaagctgctgggcaacgatgtcatgccgttcttcgaccaggac
ggcgtgcacgagatctaccgccagtggcggcgcatcctcgacgagtacagcgatgcaatg
gggcccgaagggccttccgcagaagggcgggggcgggtgacgggtgggcgcattttcgtt
gccgaggcgtggaccccgaccgtggagcgcaccgccaactacgtccgccccgacgagctg
caccaggcgttcaacttccagtacctgggcacccactgggacgccgaggagctgcgcacg
gtcatcgaccggacgctcgacgccatgcgccccgtcggcgcccccgccacctgggtcctg
tccaaccacgacgtcacccggcacgccacccgcttcgccaacccggcgggcctcggcacc
cagatccgcctggccggcgaccgcgccctgggcctgcgccgcgcccgcgccgcgaccctg
ctcatgctggccctgcccggctcggcctacgtctaccagggcgaggagctgggcctcccg
gacgtcgtcgacctgcccgacgaggtccgccaggacccggcctacttccgcggcgcgggc
caggacggcttccgcgacggctgccgggtgccgatcccgtggacccgcgagggttcctcg
tacggcttcggtgacggcggcagctggctgccgcagccggcgggctggggcgagctgagc
gtcgaggcacagaccggcgagcccggctcgaccctggagctgtaccgcgaggccctggcc
gtccgccgctccaccgccgacctcggcgcgggcgacgcggtcgagtggctgcgcgccccg
gagggcgtcgtcgccttccggcgcggggacttcgtgtgcgtcgccaacaccaccggcgag
tcggtggcggtgcccgcacacggacgcgtcctgctggccagcggggagatcaccgaggcg
gccggcgaggcgaaggtaccggcggacacgacggtgtggtggacccgcgcctga

DBGET integrated database retrieval system