KEGG   Streptomyces coelicolor: SCO2231Help
Entry
SCO2231           CDS       T00085                                 

Gene name
malE, SC10B7.26c
Definition
(RefSeq) maltose-binding protein
  KO
K15770  arabinogalactan oligomer / maltooligosaccharide transport system substrate-binding protein
Organism
sco  Streptomyces coelicolor
Pathway
sco02010  ABC transporters
Module
sco_M00491  arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:sco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SCO2231 (malE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO2231 (malE)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    SCO2231 (malE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6 SBP_bac_11
Motif
Other DBs
NCBI-GeneID: 1097664
NCBI-ProteinID: NP_626482
Kitasato: SCO2231
UniProt: Q7AKP1
Position
complement(2398988..2400259)
Genome map
AA seq 423 aa AA seqDB search
MRRGIAATALVASLALAATACGGDGDSDSESGGPVTITYWDTSNATNEAPTYKALVKEFE
AANKGVKVNFVNVPFDQAQNKFDTAAGSKGAPDVLRSEVGWTPAFAKKGFFLPLDGTEAL
AEQDKFQPNLIEQAKYEGKTYGVPLVTDTLAFVYNKELFEKAGVEAPKTWDDLKKAAATV
KDKTGVDGYWASTAGYYAQPFLYGEGTDTVDADAKKVTVNAAAAKKGYGTWLSLFDGKGL
HKADTTADAYAHIQEAFVSGKVASIIQGPWEITNFYKGTAFKDKNNLGIATVPAGSTGKA
GAPTGGHNLSVYAGSDKAHQEAALKFVNFMTSAKSQETVALKNSTLPTRDDAYTAKVKAD
PGIAGFQTVLPAAQPRPALPEYSSLWTPLDDELPQIAGGKKSLDEGLGDAETAIAKLVPD
FSK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtggcatagcggccaccgcgctggtggcgtccctcgccctggcggcgacggcg
tgcggcggagacggcgacagcgacagcgagtcgggcggaccggtcaccatcacttactgg
gacacctccaacgcgaccaacgaggcgccgacctacaaggccctggtcaaggagttcgag
gccgccaacaagggcgtcaaggtcaacttcgtcaacgtgcccttcgaccaggcgcagaac
aagttcgacaccgccgcaggctccaagggcgccccggacgtgctgcgctccgaggtcggc
tggacgcccgccttcgccaagaagggcttcttcctgccgctggacggcaccgaggccctc
gccgagcaggacaagttccagcccaacctgatcgagcaggccaagtacgagggcaagacc
tacggcgtgccgctggtcaccgacaccctcgccttcgtctacaacaaggaactgttcgag
aaggccggcgtcgaggcccccaagacctgggacgacctgaagaaggccgccgccaccgtc
aaggacaagaccggcgtcgacggctactgggcctccacggccggctactacgcgcagccg
ttcctgtacggcgagggcaccgacacggtcgacgccgacgccaagaaggtcaccgtcaac
gccgccgcggccaagaagggctacggcacctggctgagcctcttcgacggcaagggcctg
cacaaggccgacaccaccgccgacgcctacgcccacatccaggaggcgttcgtcagcggc
aaggtcgcctcgatcatccagggcccgtgggagatcaccaacttctacaagggcacggcg
ttcaaggacaagaacaacctcggcatcgccaccgtcccggccggttccaccggcaaggcg
ggcgccccgaccggcggccacaacctctcggtctacgccggttcggacaaggcgcaccag
gaggcggcgctgaagttcgtgaacttcatgacctcggcgaagtcccaggagaccgtcgcc
ctgaagaactccacgctgccgacccgcgacgacgcctacaccgcgaaggtcaaggccgac
ccgggcatcgccggcttccagacggtcctgcccgccgcccagccgcgcccggcgctgccc
gagtacagctccctgtggacgccgctggacgacgagctgccccagatcgccggcggcaag
aagtccctggacgagggtctgggcgacgccgagaccgcgatcgccaagctggtgccggac
ttcagcaagtag

DBGET integrated database retrieval system