KEGG   Streptomyces coelicolor: SCO2238Help
Entry
SCO2238           CDS       T00085                                 

Gene name
nadE, SCBAC17D6.05c
Definition
(RefSeq) NAD(+) synthase (glutamine-hydrolysing)
  KO
K01950  NAD+ synthase (glutamine-hydrolysing) [EC:6.3.5.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00760  Nicotinate and nicotinamide metabolism
sco01100  Metabolic pathways
Module
sco_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO2238 (nadE)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.1  NAD+ synthase (glutamine-hydrolysing)
     SCO2238 (nadE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_synthase CN_hydrolase Asn_synthase Tic22
Motif
Other DBs
NCBI-GeneID: 1097671
NCBI-ProteinID: NP_626488
Kitasato: SCO2238
UniProt: Q9ADI8
Position
complement(2406988..2408829)
Genome map
AA seq 613 aa AA seqDB search
MRSRTSGGNTPVAPLRRSDDYSGAVPRLRLALNQIDSTVGDIDGNAESVLHWTRHSAERG
AHLVAFPEMTLTGYPVEDLALRSSFVEASRAALRSLAARLADEGLGTVPVIVGHLDRSAT
AQPRYGQPAGAPQNAAAVLYGGEVALSFAKHHLPNYGVFDEFRYFVPGDTLPVVRVRGVD
VALAICEDLWQDGGRVPAARSARAGLLLSVNASPYERDKDDTRLELVRRRAQEAGCTTAY
LAMTGGQDELVFDGDSIVVDRDGTVLARAPQFTEGCMVLDLDLPAADADPPTGVVDDGLR
IDRVVLPGEAGREQPLPAGEPWLSGGHAEPLDDDEEVYSALVTGLRAYVAKNGFRSVLIG
LSGGIDSALVASIACDALGAEHVYGVSMPSKYSSGHSRDDAAELARRTGLHYRTVSIEPM
FDAYTGALELTGLAEENLQSRLRGTLLMALSNQEGHLVLAPGNKSELAVGYSTLYGDSVG
GYGPIKDVYKTSVFRLAEWRNRAARDRGRTPPVPENSITKPPSAELRPGQVDTDSLPDYP
VLDAILALYVDRDRGADEIVAAGYDRELVTRTLRMVDTAEYKRRQYPPGTKISPKGFGKD
RRLPVTNRWRESR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtctcggacatcaggcggtaacacgcccgtcgccccattgcgtcgttctgacgat
tacagtggggccgtgccccgactacgactcgccctcaaccagatcgactccaccgtcggc
gacatcgacggcaacgccgagtcggtcctgcactggacccggcactcggccgaacgggga
gcgcacctggtggcgttcccggagatgacgctgaccgggtacccggtggaggacctggcc
ctcaggtcctccttcgtcgaggcctcccgcgccgccctgcgctcgctcgcggcgcggctg
gcggacgagggcctcggcaccgtccccgtcatcgtcggccacctcgaccgctcggcgacc
gcgcagcccaggtacggccagcccgccggcgccccgcagaacgcggcggccgtgctgtac
ggcggcgaggtggcgctgagcttcgccaagcaccacctgccgaactacggcgtcttcgac
gagttccgctacttcgtgcccggcgacaccctgcccgtggtgcgggtgcgcggcgtggac
gtggcgctggccatctgcgaggacctgtggcaggacggcggccgggtgcccgccgcccgc
tcggcgcgggccggactgctgctctccgtcaacgcctccccgtacgagcgcgacaaggac
gacacccggctggagctggtgcgcaggcgagcgcaggaggccgggtgcaccaccgcctac
ctggccatgaccggcgggcaggacgagctggtcttcgacggcgactcgatcgtcgtcgac
cgggacgggaccgtcctggcccgggcgccgcagttcaccgagggctgcatggtgctggac
ctcgacctgcccgccgcggacgcggacccgcccacgggcgtcgtggacgacggactgcgc
atcgaccgggtggtgctccccggggaggccgggcgggagcagccgctgcccgccggtgag
ccctggctgtcgggcgggcacgccgagccgctggacgacgacgaggaggtctactcggcg
ctcgtcaccggcctgcgcgcgtacgtcgcgaagaacggcttccgctcggtgctgatcgga
ctgtccggcggcatcgactccgcgctggtcgcgtcgatcgcctgcgacgcgctcggcgcg
gagcacgtgtacggcgtctccatgccctccaagtactcctcggggcactccagggacgac
gcggccgagctggcccgccgcaccggcctgcactaccgcaccgtgtccatcgagccgatg
ttcgacgcgtacacgggtgcgctggagctgaccggcctggcggaggagaacctccagtcc
cggctgcgcggcacgctgctgatggcgctctccaaccaggagggccacctcgtgctggcc
cccggcaacaagtcggagctggcggtcggctactccacgctgtacggcgactcggtgggc
ggctacgggcccatcaaggacgtgtacaagacgtcggtcttccggctcgccgagtggcgc
aaccgcgcggcccgggaccgcggccggaccccgccggtcccggagaactcgatcaccaag
ccgccgagcgcggagctgcgcccgggccaggtcgacacggactcgctgccggactacccg
gtgctggacgcgatcctcgccctgtacgtcgaccgggaccggggcgcggacgagatcgtg
gccgccggatacgaccgggagctggtgacgcggacgctgcgcatggtggacaccgccgag
tacaagcggcggcagtacccgccgggcaccaagatctcgcccaagggcttcggcaaggac
cgccgcctgccggtcaccaaccgctggcgggagagccgctga

DBGET integrated database retrieval system