KEGG   Streptomyces coelicolor: SCO2241Help
Entry
SCO2241           CDS       T00085                                 

Gene name
SC1G2.03
Definition
(RefSeq) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00220  Arginine biosynthesis
sco00250  Alanine, aspartate and glutamate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00910  Nitrogen metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01230  Biosynthesis of amino acids
sco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2241 (SC1G2.03)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SCO2241 (SC1G2.03)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO2241 (SC1G2.03)
   00220 Arginine biosynthesis
    SCO2241 (SC1G2.03)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCO2241 (SC1G2.03)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO2241 (SC1G2.03)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     SCO2241 (SC1G2.03)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO2241 (SC1G2.03)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N Gln-synt_N_2
Motif
Other DBs
NCBI-GeneID: 1097674
NCBI-ProteinID: NP_626490
Kitasato: SCO2241
UniProt: Q9RDS6
Position
2410423..2411784
Genome map
AA seq 453 aa AA seqDB search
MDKQQEFVIRTLEERDIRFVRLWFTDVLGFLKSVAVAPAELEQAFDEGIGFDGSAIEGFA
RVYESDMIAKPDPSTFQVLPWRAEAPGTARMFCDILMPDGSPSFADPRYVLKRALARTSD
LGFTFYTHPEIEFFLLKDKPVDGSVPTPADNSGYFDHTPQNIGMDFRRQAITMLESMGIS
VEFSHHEGAPGQQEIDLRYADALSTADNVMTFRLVMKQVALEQGLQATFMPKPFSEYPGS
GMHTHLSLFEGDRNAFYESGAEYQLSKVGRSFIAGLLRHAAEISAVTNQWVNSYKRIWGG
TERTAGAGGEAPSYICWGHNNRSALVRVPMYKPGKTGSARVEVRSIDSGANPYLTYAVLL
AAGLKGIEEGYELPPGAEDDVWALSDAERRALGIEPLPQNLGEALALMERSDLVAETLGE
HVFDFFLRNKRQEWEEYRSQVTAFELRKSLPVL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcagcaggagttcgtgatccggacgctggaggagcgcgacatccggttcgta
cgcctgtggttcacggacgtgctgggcttcctcaagtccgtcgccgtggccccggccgag
ctggagcaggccttcgacgagggcatcggcttcgacggctccgcgatcgagggcttcgcc
cgggtctacgagtccgacatgatcgccaagccggacccgtcgaccttccaggtcctgccg
tggcgcgcggaggcccccggcacggcccgtatgttctgcgacatcctcatgccggacggc
tcgccgtccttcgcggacccgcgctacgtgctcaagcgggccctggcccgcacctccgac
ctgggcttcaccttctacacccacccggagatcgagttcttcctgctgaaggacaagccc
gtcgacggctcggtcccgacccccgccgacaactccggctacttcgaccacaccccgcag
aacatcggcatggacttccgccgccaggcgatcaccatgctggagtcgatgggcatctcg
gtggagttctcccaccacgagggtgcccccggccagcaggagatcgacctgcgctacgcg
gacgcgctctccacggccgacaacgtcatgaccttccgcctggtcatgaagcaggtggcc
ctcgaacagggcctccaggccaccttcatgccgaagccgttctcggagtatcccggctcg
ggcatgcacacccacctctccctcttcgagggcgaccgcaacgcgttctacgagtccggc
gcggagtaccagctctccaaggtgggccgctccttcatcgcgggcctgctgcgccacgcc
gccgagatctccgcggtcaccaaccagtgggtgaactcctacaagcgcatctggggcggt
accgagcgcaccgccggcgcgggcggcgaggccccctcctacatctgctggggccacaac
aaccgctcggccctggtccgggtcccgatgtacaagcccggcaagaccggctcggcccgc
gtcgaggtccgctccatcgactccggcgccaacccgtacctcacctacgccgtcctcctc
gccgccggcctcaagggcatcgaggagggctacgaactcccgccgggcgccgaggacgac
gtctgggccctctccgacgcggagcgccgcgccctgggcatcgagcccctcccccagaac
ctgggcgaggctctcgccctgatggaacgcagcgacctggtcgccgagaccctgggcgaa
cacgtcttcgacttcttcctccgcaacaagcgccaggagtgggaggagtaccggtcccag
gtgacggcgttcgagctgcggaagtcgctgccggtgctgtag

DBGET integrated database retrieval system