KEGG   Streptomyces coelicolor: SCO2298Help
Entry
SCO2298           CDS       T00085                                 

Gene name
kdgA, SCC30.06
Definition
(RefSeq) KHG/KDPG aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO2298 (kdgA)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2298 (kdgA)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     SCO2298 (kdgA)
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     SCO2298 (kdgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase IMPDH
Motif
Other DBs
NCBI-GeneID: 1097732
NCBI-ProteinID: NP_626546
Kitasato: SCO2298
UniProt: Q9L015
Position
2467437..2468096
Genome map
AA seq 219 aa AA seqDB search
MSSPLPSSPAASVLDLAPVVPVVVVDDLADAVPLARALVAGGLPAIEVTLRTPVALDAIR
AIAGEVPDAVVGAGTVVTAEQVGEVVAAGARFLVSPGWTDTLVEAMRGSGVPFLPGVSTA
SEVVALLERGVREMKFFPAEAAGGTAYLKALAAPLPQARFCPTGGITPASAPEYLALPNV
GCVGGSWMLPKDAIAGRDWARVEALAREAAALSAGGTSR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagttctccgctgccctcctcccccgccgcctcggtgctggatctcgcgcccgtcgtg
cccgtcgtggtcgtcgacgacctcgccgacgccgtgccgctcgccagggcgctcgtcgcc
ggcgggctgcccgcgatcgaggtgacgctgcggacgccggtcgccctcgacgcgatccgg
gccatcgccggtgaggtgccggacgcggtggtcggcgcgggcaccgtcgtcacggcggaa
caggtcggtgaggtcgtggcggccggggcgcggttcctggtcagcccggggtggacggac
acgctggtggaggccatgcgcgggtccggggtgccgttcctgccgggggtgtcgaccgcc
tcggaggtggtggcgctgctggagcgcggggtgcgcgagatgaagttcttcccggccgag
gcggcgggcggcaccgcctacctcaaggcgctcgccgcgccgttgccgcaggcgcgcttc
tgcccgaccggcggcatcaccccggcctccgcgccggagtacctggccctgcccaacgtc
ggctgcgtggggggcagttggatgctacccaaggacgcgatcgccgggcgggactgggcg
cgcgtggaggcgctggcccgggaggcggccgcgctcagcgcaggtgggacgtctcgttga

DBGET integrated database retrieval system