KEGG   Streptomyces coelicolor: SCO2346Help
Entry
SCO2346           CDS       T00085                                 

Gene name
SCC8A.04c
Definition
(RefSeq) hydrolase
  KO
K19270  sugar-phosphatase [EC:3.1.3.23]
Organism
sco  Streptomyces coelicolor
Brite
KEGG Orthology (KO) [BR:sco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCO2346 (SCC8A.04c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.23  sugar-phosphatase
     SCO2346 (SCC8A.04c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 1097780
NCBI-ProteinID: NP_626593
Kitasato: SCO2346
UniProt: Q9KY44
Position
complement(2515998..2516663)
Genome map
AA seq 221 aa AA seqDB search
MTATASTVLPARALLLDMDGTLVNSDAAVDRVWRRWADRHGLDGDEVMKVVHGRQGYASM
ALLLPDRPMEHNHADNARMLAEETADTEGVVAIPGAAEFLASLRGLPHALVTSADVALST
ARMAAAGLAQPDVRVTAESVGASKPDPEGFLKGAAELGIAPADCVVFEDSGAGIAAGRAA
GMRVVGVGPRAGFHGPDVVVEDLTRVRVEADADGGLRLHIG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaccgccagcaccgttctgcccgcccgcgccctgctgctcgacatggacggc
accctcgtcaactcggacgccgccgtggaccgcgtctggcggcgctgggccgaccggcac
ggactggacggcgacgaggtcatgaaggtcgtccacggacggcagggctacgcctcgatg
gcgctgctgctgccggaccggcccatggagcacaaccacgccgacaacgcgcgcatgctc
gccgaggagaccgccgacaccgagggcgtcgtcgcgatccccggcgccgcggagttcctc
gcctcgctgcgcgggctgccgcacgccctggtgacctcggccgacgtggccctgtccacc
gcgcggatggccgccgccgggctcgcgcagccggacgtccgggtcaccgccgagtcggtc
ggcgcgagcaagcccgacccggagggcttcctcaagggcgccgccgaactgggcatcgcc
cccgccgactgcgtcgtcttcgaggactccggcgccggcatcgcggccgggcgcgccgcc
gggatgcgggtcgtcggggtaggaccgcgcgccgggttccacgggccggacgtggtcgtg
gaggacctgacgcgggtgcgtgtcgaggcagacgcggacggcgggctgcgcctgcacatc
ggctga

DBGET integrated database retrieval system