KEGG   Streptomyces coelicolor: SCO2387Help
Entry
SCO2387           CDS       T00085                                 

Gene name
fabD, SC4A7.15
Definition
(RefSeq) ACP S-malonyltransferase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
sco  Streptomyces coelicolor
Pathway
sco00061  Fatty acid biosynthesis
sco00333  Prodigiosin biosynthesis
sco01100  Metabolic pathways
sco01130  Biosynthesis of antibiotics
sco01212  Fatty acid metabolism
Module
sco_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SCO2387 (fabD)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SCO2387 (fabD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sco01004]
    SCO2387 (fabD)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     SCO2387 (fabD)
Lipid biosynthesis proteins [BR:sco01004]
 Fatty acid synthase
  Component type
   SCO2387 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1
Motif
Other DBs
NCBI-GeneID: 1097821
NCBI-ProteinID: NP_626633
Kitasato: SCO2387
UniProt: P72391 Q7AKN9
Structure
PDB: 

Position
2559340..2560290
Genome map
AA seq 316 aa AA seqDB search
MLVLVAPGQGAQTPGFLTDWLALPGAADRVAAWSDAIGLDLAHFGTKADADEIRDTSVAQ
PLLVAAGILSAAALGTQTSVADATGPGFTPGAVAGHSVGEITAAVFAGVLDDTAALSLVR
RRGLAMAEAAAVTETGMSALLGGDPEVSVAHLERLGLTPANVNGAGQIVAAGTMEQLAAL
NEDKPEGVRKVVPLKVAGAFHTRHMAPAVDKLAEAAKALTPADPKVTYVSNKDGRAVASG
TEVLDRLVGQVANPVRWDLCMETFKELGVTAIIEVCPGGTLTGLAKRALPGVKTLALKTP
DDLDAARELVAEHTQA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgtactcgtcgctcccggccagggcgcccagacgcccggcttcctgactgactgg
ctcgccctccccggtgccgctgaccgcgtcgccgcgtggtcggacgccatcggactcgat
ctcgcccacttcggcaccaaggccgacgcggacgagatccgagacacgtccgtggcccag
ccgctgctggtcgccgccggaatcctgtccgccgcggcactcggtacgcagacatctgtc
gctgacgcgacgggccccgggttcacccccggcgcggtcgccggacacagcgtcggcgag
atcaccgccgccgtcttcgcgggcgtcctcgacgacaccgccgcgctgtccctcgtacgc
cgtcgcggcctggccatggccgaggccgcggcggtcaccgagaccggcatgtcggcgctg
ctcgggggcgaccccgaggtgagcgtcgcgcacctggagcggctcggcctgaccccggcg
aacgtgaacggcgccggtcagatcgtggcggcgggcaccatggagcagctggccgcgctg
aacgaggacaagcccgagggtgtgcgcaaggtcgtcccgctgaaggtggccggcgcgttc
cacacccgccacatggcccccgccgtggacaagctcgccgaggccgccaaggcgctgacg
ccggccgacccgaaggtgacgtacgtctccaacaaggacgggcgggccgtcgcctccggc
accgaggtgctggaccggctggtcggccaggtcgccaacccggtgcgctgggacctgtgc
atggagacgttcaaggagctgggcgtcaccgcgatcatcgaggtgtgtccgggcggcacg
ctgaccgggctggccaagcgggcgctgcccggagtgaagacgctggccctgaagaccccc
gacgacctcgacgcggcccgtgagctcgtcgccgagcacacccaggcctga

DBGET integrated database retrieval system