KEGG   Streptomyces coelicolor: SCO2393Help
Entry
SCO2393           CDS       T00085                                 

Gene name
SC4A7.21
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00052  Galactose metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Module
sco_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO2393 (SC4A7.21)
   00052 Galactose metabolism
    SCO2393 (SC4A7.21)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SCO2393 (SC4A7.21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 1097827
NCBI-ProteinID: NP_626639
Kitasato: SCO2393
UniProt: Q9RDP4
Position
2564900..2565871
Genome map
AA seq 323 aa AA seqDB search
MSELFGTLSDGTPVHRWTLERAGVRVRVLSYGGIVQSAEVPDRDGHTADVVLGFADLDGY
VAHPEPYFGALVGRYANRIAGGRFPLDGRTYALAPNEGPNTLHGGTRGFDKRVWDVAAVE
EGVRLSRVSPHGEEGFPGRLEMSVTYTLDGSGALRIAYEAVTDAPTVLNPTNHSYFNLSG
SGHAGGHELRLAASRITPVDAGLIPTGGLDDVTDTRFDFRRARKVGSGYDHNYVLDKGVT
EAAEKVAELYDPASGRVLTVATTEPGLQLYTADHLGEPFAPGDGIALETQHFPDSPNRPG
FPSTVLRPGEVFRSETVYGFSVR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactcttcggcacactttccgacggcaccccggtacaccgctggaccctggag
cgggccggcgtccgggtacgggtcctgtcgtacggcgggatcgtgcagtcggccgaggtg
cccgaccgggacggtcacaccgccgacgtggtcctggggttcgcggacctggacggctat
gtggcgcacccggagccgtacttcggcgcgctggtcgggcggtacgccaaccggatcgcg
ggcgggcgcttcccgctggacggccggacgtacgcgctggcgcccaacgaggggcccaac
acgctgcacggcggcacccggggcttcgacaagcgcgtgtgggacgtggcggcggtcgag
gagggcgtccggctgagccgggtctccccgcacggcgaggagggctttccggggcggctg
gagatgtcggtgacgtacacgctggacgggtcgggcgcgctgcggatcgcctacgaggcg
gtcacggacgcgccgaccgtgctgaacccgaccaaccacagctacttcaacctgagcggc
tccgggcacgcgggcgggcacgaactgcggctggccgcctcccggatcacgccggtcgac
gccggcctgatcccgaccggcggcctcgacgacgtgacggacacgcgcttcgacttccgg
cgggcgcgcaaggtcggctcgggctacgaccacaactacgtcctggacaagggtgtgacc
gaggccgccgaaaaggtcgccgagctgtacgacccggcgtcgggacgggtgctcacggtg
gcgacgaccgagccgggcctccagctgtacaccgccgaccacctgggcgagccgttcgcc
cccggggacgggatcgcgctggagacccagcacttccccgactccccgaaccggcccggc
ttcccgagcacggtgctgcggccgggcgaggtgttccgctcggagacggtgtacggcttc
tcggtgcggtag

DBGET integrated database retrieval system