KEGG   Streptomyces coelicolor: SCO2455Help
Entry
SCO2455           CDS       T00085                                 

Gene name
SCC24.26c
Definition
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
sco00270  Cysteine and methionine metabolism
sco00330  Arginine and proline metabolism
sco00410  beta-Alanine metabolism
sco00480  Glutathione metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO2455 (SCC24.26c)
   00330 Arginine and proline metabolism
    SCO2455 (SCC24.26c)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO2455 (SCC24.26c)
   00480 Glutathione metabolism
    SCO2455 (SCC24.26c)
Enzymes [BR:sco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     SCO2455 (SCC24.26c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Methyltransf_25 Methyltransf_11 Myc_target_1 Methyltransf_12 Spermine_synt_N
Motif
Other DBs
NCBI-GeneID: 1097889
NCBI-ProteinID: NP_626698
Kitasato: SCO2455
UniProt: Q9L091
Position
complement(2642344..2643939)
Genome map
AA seq 531 aa AA seqDB search
MSSALDDRAVAAPPNPPADHHTRGARFLLLLAVFLCAACGLVYELALTALGSYLIGNSVL
QTSVVISVMVFAMGVGSLAAKPLRHRPVVAFAVVEGVLALVGGLSVLMLYAAFAWLQLYM
PAMIVVSLVVGLLIGAEIPLLMTLLQRIRTQEASSAVADMFAVDYIGALVGGLCFPLFLL
PTFGQLKGALVVGVVNAVAGVIVVVFIFRRQTGRLVKAGLLAGVALVLAALGTTYVLADD
LEVTARQHMYADPIIHSETTQYQDIVVTRSTAFTGEPDVRLFLNGDLQFSSVDEYRYHES
LVHPALSGPHSNVLIMGGGDGLALREVLRHEGVRHVTLVELDPAMTRLARTFEPLRKLNQ
GSLDDPRAKVVNADAFTWLREARQQYDAVIIDFPDPDSASLAKLYSVEFYDLLRRVLAPD
GQVMVQSGSPFFAPKTYWSIAKTIETAGYATTEFQIDVPSFGNWGFVLARPGTEAPPLRL
ARDTPKLRYLDAAVLKAATVFPVDRRRTDVRPSTLMDPAVLEYVQDEWRDY
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgagttccgccctggacgaccgtgccgtcgcggcgcccccgaaccccccggccgaccac
cacacccggggggcgcggttcctgctgctgctcgccgtcttcctctgcgcggcctgcggc
ctcgtgtacgaactggccctgaccgcgctgggcagctacctcatcggcaactcggtgctg
cagacctccgtggtcatctccgtgatggtcttcgccatgggcgtgggctcgctggccgcc
aaacccctgcgccaccgccccgtcgtcgccttcgcggtggtggagggagtactcgcgctg
gtcggcggtctgtccgtcctgatgctgtacgcggccttcgcctggctccagctctacatg
cccgcgatgatcgtggtgtccctggtggtgggcctgctcatcggcgccgagatcccgctg
ctgatgacgctgctccagcgcatccgcacgcaggaggcgagcagcgccgtcgccgacatg
ttcgccgtcgactacatcggcgccctcgtcggcggcctgtgcttcccgctgttcctgctg
ccgaccttcggccagttgaagggcgcgctggtggtcggcgtggtcaacgcggtcgccggg
gtcatcgtcgtggtgttcatcttccgccgccagaccggccggctggtcaaggccgggctg
ctggccggcgtcgccctggtgctcgccgcgctcggtacgacgtatgtgctggcggacgac
ctggaggtgacggcgcgccagcacatgtacgcggacccgatcatccactccgagacgacg
cagtaccaggacatcgtggtcacccgctccaccgccttcaccggcgagcccgacgtacgg
ctcttcctcaacggcgacctccagttcagctcggtcgacgagtaccgctaccacgagtcg
ctggtccaccccgcgctgtccggcccccactccaacgtgctgatcatgggcggcggtgac
gggctcgcgctgcgcgaggtgctgcgccacgagggcgtccggcacgtcaccctggtcgaa
ctggacccggcgatgacccggttggcgcgcaccttcgagccgctgcgaaagctcaaccag
ggttcgctggacgatccgcgggccaaggtcgtcaacgcggacgccttcacctggctgcgc
gaggcacggcagcagtacgacgcggtgatcatcgacttcccggacccggactcggcgtcg
ctggcgaagctgtactcggtggagttctacgatctgctccgccgggtgctggcgccggac
ggccaggtcatggtgcagagcggatcgccgttcttcgcccccaagacctactggtcgatc
gcgaagaccatcgagacggccgggtacgcgacgacggagttccagatcgacgtgccgagc
ttcggcaactggggcttcgtcctcgcccgccccggaaccgaggccccgccgctgcggctc
gcccgggacacgccgaagctgcgctacctggacgcggcggtcctgaaggcggccaccgtg
ttccccgtcgaccgccgccgcaccgacgtacggccgagcaccctgatggatcccgcggtg
ctcgaatacgttcaggacgagtggcgcgactactga

DBGET integrated database retrieval system