KEGG   Streptomyces coelicolor: SCO2486Help
Entry
SCO2486           CDS       T00085                                 

Gene name
nirB, SC7A8.25
Definition
(RefSeq) nitrite reductase NirB
  KO
K00360  assimilatory nitrate reductase electron transfer subunit [EC:1.7.99.-]
Organism
sco  Streptomyces coelicolor
Pathway
sco00910  Nitrogen metabolism
sco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SCO2486 (nirB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     SCO2486 (nirB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO GIDA Amino_oxidase NAD_binding_9 Pyr_redox_3 HI0933_like NAD_binding_8 AlaDh_PNT_C FAD_binding_3 3HCDH_N Lycopene_cycl FAD_binding_2 adh_short_C2 NAD_binding_7 Trp_halogenase ThiF FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 1097920
NCBI-ProteinID: NP_626728
Kitasato: SCO2486
UniProt: Q9L2D3
Position
2676046..2677278
Genome map
AA seq 410 aa AA seqDB search
MTSKTRVVVIGAGLAGVTLARRLGELGTPALTLGDEEHRPYNRVLLAEVLAGRYGPEVIA
LPAPAGLLRGRVTGIDRAGRTVRCADGSVIAYDTLVLATGSNAVLPPLRGLFTPDHELPE
GVHAFRTMDDCLGLSKAVRPGVRAVVIGGGLLGVSAARALAVRGAQVVLAQQSERLMERQ
LDPAASALVRRHLEGLGVEVHTECRVRDVRSVGGAVRSVEMGDGYALGADLVVLACGVRP
RAGLAREAGLAVGKGVLVDDELRTSDPHIRAIGDCAQHADHVYGLAAPALEQAGVLAELL
AEGGTATRHYTGTRALTRLTLTGADSPFAPLDLAAFGETDPRPGDDVVQLADATRGTYRK
VVVRDDRLVGGVLVGELGTVGALARAWEGAEPLPSDGGPLLHLLTQDGGS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgaaaacgcgtgtggtggtgatcggcgccggactggcgggtgtgacgctcgcc
cggcggctcggtgagctgggcacgcccgcgctgaccctcggcgacgaggagcaccgcccg
tacaaccgggtgctgctcgccgaggtgctggccggacggtacggccccgaggtgatcgcc
ctgccggcgcccgccgggctgctgcgcggccgggtcaccggcatcgaccgggccgggcgg
accgtgcgctgcgccgacgggtccgtgatcgcgtacgacacgctggtcctggccaccggc
tccaacgcggtgctgccgcccctgcgcggcctgttcaccccggaccacgagctgcccgag
ggcgtgcacgcgttccggacgatggacgactgcctcgggttgtcgaaggcggtacggccg
ggggtgcgggccgtagtgatcggcggcgggctgctcggggtgtccgccgcccgtgcgctg
gccgtgcgcggcgcccaggtcgtgctcgcccagcagtccgagcggctgatggagcggcag
ctcgacccggcggcctccgcgctggtgcggcggcacctggagggcctcggcgtggaggtg
cacaccgagtgccgggtacgggacgtgcgcagcgtcggcggggcggtgcggtcggtggag
atgggcgacgggtacgccctcggcgccgacctggtggtgctcgcgtgcggggtgcggccg
cgggccgggctggcgcgggaggcggggctggcggtcggcaaaggcgtcctcgtcgacgac
gagctgcgcacctccgacccgcacatccgcgcgatcggcgactgcgcccagcacgcggac
cacgtctacggcctggccgcgcccgccctcgaacaggccggggtgctggccgaactgctc
gcggagggcgggaccgccacccggcactacaccggcacccgcgcactgacccggctcacc
ctcaccggggcggacagcccgttcgcccccctcgacctcgccgcgttcggcgagaccgac
ccccgccccggcgacgacgtcgtgcagctcgccgacgccacccggggcacctaccgcaag
gtcgtcgtccgcgacgaccggctggtgggcggggtgctggtcggcgaactcggcaccgtc
ggcgcgctggcgcgcgcctgggagggagcagagccgctcccctccgacggcggccccctg
ctccacctgctcacccaagacggaggctcctga

DBGET integrated database retrieval system