KEGG   Streptomyces coelicolor: SCO2494Help
Entry
SCO2494           CDS       T00085                                 

Gene name
SC7A8.33c
Definition
(RefSeq) pyruvate phosphate dikinase
  KO
K01006  pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO2494 (SC7A8.33c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     SCO2494 (SC7A8.33c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PPDK_N PEP-utilizers Dabb HECT
Motif
Other DBs
NCBI-GeneID: 1097928
NCBI-ProteinID: NP_626736
Kitasato: SCO2494
UniProt: Q9L2C5
Position
complement(2684904..2687633)
Genome map
AA seq 909 aa AA seqDB search
MSENKDPQVANAAKFVYDFTEGNKDLKDLLGGKGANLAEMTNLGLPVPPGFTITTEACKT
YLDSGEEPAALRDEVSAHLDALEATMGKKLGQADDPLLVSVRSGAKFSMPGMMDTVLNIG
LSDKSVQGLAKQAGDDRFAWDSYRRLIQMFGKTVLGVDGDLFEEALEAAKTAKKVAVDTE
LEAADLKKLVTKFKKIVKTEAGRDFPQDPREQMDLAIKAVFESWNGERAKLYRRQERIPH
DLGTAVNVCSMVFGNLGPDSGTGVAFTRDPASGHQGVYGDYLQNAQGEDVVAGIRNTVAL
ADLEQIDKKSYDQLMQIMETLENHYLDLCDIEFTIERGQLWMLQTRVGKRTAGAAFRIAT
QLVDQGLIDEAEALQRVNGAQLAQLMFPRFDDEAKVEKVGRGIAASPGAAVGKAVFDSYT
AVKWSRSGEKVILVRRETNPDDLDGMIAAEGILTSRGGKTSHAAVVARGMGKTCVCGAEE
LEVDTKRRRMTVPGGHVVEEGDVISIDGSSGKVYLGEVPVVPSPVVEYFEGRMHAGAEDA
DELVEAVHRIMAFADRKRRLRVRANADNAEDALRARRFGAQGIGLCRTEHMFLGDRRELV
ERLILADTEAVREESLKELLPLQKQDFVQLFESMDGLPVTVRLLDPPLHEFLPDITELSV
RVALAESRQEPHENELRLLQAVHRLHEQNPMLGLRGVRLGLVIPGLFTMQVRAIAEAAAE
RKAAKGDPRAEIMIPLVGTVQELEIVREEADQVIAEVEAATGAKLKLSIGTMIELPRAAL
TAGQIAEAAEFFSFGTNDLTQTVWGFSRDDVEASFFTAYLEKGIFGVSPFETIDKDGVGS
LVAAAAKAGRATRPDLKLGVCGEHGGDPESVHFFHEVGLDYVSCSPFRIPVARLEAGRAA
SRSKGSDHR
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggaaaacaaagatccccaggtagcgaacgcagcgaagttcgtttacgacttcacc
gagggcaacaaggacctcaaggacctcctcggcggcaagggcgccaacctcgccgagatg
accaacctgggtctcccggtccctcccggcttcacgatcaccaccgaggcctgcaagacc
tacctcgacagcggcgaggagcccgcggcactgcgtgacgaggtgagtgcgcacctcgac
gccctggaagccacgatgggcaagaagctcggccaggccgacgaccccctcctcgtgtcg
gtccgctccggggccaagttctccatgcccggcatgatggacaccgtcctcaacatcggc
ctctccgacaagtccgtgcagggcctggccaagcaggccggcgacgaccgcttcgcgtgg
gactcctaccgccgcctgatccagatgttcggcaagaccgtcctcggcgtcgacggcgac
ctcttcgaggaggcgctggaggcggccaagacggccaagaaggtcgcggtcgacaccgag
ctggaggccgccgacctcaagaagctcgtcaccaagttcaagaagatcgtcaagaccgag
gccggccgggacttcccgcaggacccgcgcgagcagatggacctcgccatcaaggcggtc
ttcgagtcctggaacggcgagcgcgccaagctctaccgccgccaggagcgcatcccgcac
gacctcggcaccgccgtcaacgtgtgctccatggtcttcggcaacctcggccccgactcc
ggcaccggcgtcgccttcacccgcgaccccgcctccgggcaccagggcgtctacggcgac
tacctccagaacgcccagggcgaggacgtcgtcgcgggcatccgcaacaccgtcgcgctg
gcggacctggagcagatcgacaagaagtcgtacgaccagctgatgcagatcatggagacg
ctggagaaccactacctggacctgtgcgacatcgagttcaccatcgagcgcggtcagctg
tggatgctccagacccgcgtcggcaagcgcaccgcgggcgccgccttccggatcgccacc
cagctcgtcgaccagggcctgatcgacgaggccgaggccctccagcgggtcaacggcgcc
cagctcgcccagctgatgttcccccgcttcgacgacgaggcgaaggtcgagaaggtcggc
cggggcatcgccgcctcgccgggcgcggcggtcggcaaggccgtcttcgactcgtacacc
gccgtcaagtggtcccggtccggcgagaaggtcatcctggtccgccgcgagaccaacccc
gacgacctggacggcatgatcgccgccgagggcatcctgacctcgcgcggcggcaagacc
tcccacgcggccgtggtggcgcgcggcatgggcaagacctgtgtctgcggcgccgaggaa
ctggaggtcgacaccaagcgccgccggatgaccgtgcccggcgggcacgtcgtcgaggag
ggcgacgtgatctccatcgacggctcctccggcaaggtctacctcggcgaggtgccggtc
gtgccctccccggtcgtcgagtacttcgagggccggatgcacgcgggcgccgaggacgcc
gacgagctggtcgaggccgtgcaccggatcatggccttcgccgaccgcaagcgccggctg
cgggtgcgcgccaacgccgacaacgccgaggacgcgctgcgcgcccgccggttcggtgcc
cagggcatcgggctgtgccgcaccgagcacatgttcctcggcgaccggcgcgagctggtg
gagcggctgatcctcgccgacaccgaggcggtgcgcgaggagtccctcaaggagctgctg
ccgctccagaagcaggacttcgtccagctcttcgagtcgatggacggcctcccggtcacg
gtccgcctcctcgacccgccgctgcacgagttcctgcccgacatcaccgaactgtcggta
cgtgtggcgctcgcggagtcccgtcaggagccgcacgagaacgagctgcgcctgctccag
gccgtgcaccggctgcacgagcagaacccgatgctgggcctgcgcggggtgcgcctcggc
ctggtcatccccggcctgttcaccatgcaggtccgcgccatcgccgaggccgcggccgag
cgcaaggcggccaagggcgacccgcgcgccgagatcatgatcccgctggtcggcaccgtc
caggagctggagatcgtccgcgaggaggccgaccaggtcatcgccgaggtcgaggccgcc
accggcgccaagctcaagctgtcgatcggcacgatgatcgagctgccgcgcgccgcgctg
accgccgggcagatcgccgaggccgcggagttcttctccttcggcaccaacgacctgacc
cagaccgtgtggggcttcagccgcgacgacgtcgaggccagcttcttcacggcctacctg
gagaagggcatcttcggcgtctccccgttcgagaccatcgacaaggacggtgtcggctcc
ctggtcgccgccgccgcgaaggccggccgcgccacgcgtcccgacctgaagctcggcgtc
tgcggcgagcacggcggcgacccggagtcggtccacttcttccacgaggtgggtctggac
tacgtctcctgctccccgttccggatcccggtggcccgcctggaggcgggccgggcggcg
tcgcggtcgaagggcagcgaccaccggtaa

DBGET integrated database retrieval system