KEGG   Streptomyces coelicolor: SCO2528Help
Entry
SCO2528           CDS       T00085                                 

Gene name
leuA, SCC121.31c
Definition
(RefSeq) 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
sco  Streptomyces coelicolor
Pathway
sco00290  Valine, leucine and isoleucine biosynthesis
sco00620  Pyruvate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO2528 (leuA)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO2528 (leuA)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     SCO2528 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer
Motif
Other DBs
NCBI-GeneID: 1097962
NCBI-ProteinID: NP_733575
Kitasato: SCO2528
UniProt: O31046
Position
complement(2725480..2727201)
Genome map
AA seq 573 aa AA seqDB search
MANRQQPSPMPTAKYRGYDQVDIADRTWPNQRITTAPRWLSTDLRDGNQALIDPMSPVRK
RAMFDLLVKMGYKEIEVGFPASGQTDFDFVRSIIEEPGAIPDDVTISVLTQAREDLIERT
VESLKGARRATVHLYNATAPVFRRVVFRGSRDDIKQIAVDGTRLVMEYAEKLLGPETEFG
YQYSPEIFTDTELDFALEVCEAVMDTYQPGPGREIILNLPATVERSTPSTHADRFEWMGR
NLSRREHVCLSVHPHNDRGTAVAAAELALMAGADRIEGCLFGQGERTGNVDLVTLGMNLF
SQGVDPQIDFSDIDEIRRTWEYCNQMEVHPRHPYVGDLVYTSFSGSHQDAIKKGFDAMEA
DAAARGVTVDDIEWAVPYLPIDPKDVGRSYEAVIRVNSQSGKGGIAYVLKNDHSLDLPRR
MQIEFSKLIQAKTDAEGGEITPTAIWDVFQDEYLPNPDNPWGRIQVANGQTTTDRDGVDT
LTVDATVDGAETTLVGSGNGPISAFFHALQGVGIDVRLLDYQEHTMSEGASAQAASYIEC
AIGDKVLWGIGIDANTTRASLKAVVSAVNRATR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccgccagcagcccagccccatgccgaccgccaagtaccgcggctacgaccag
gtcgacatcgccgaccgcacctggccgaaccagcggatcaccaccgctccccgctggctc
tccaccgacctgcgcgacggcaaccaggccctgatcgaccccatgtcgccggtccgcaag
cgcgccatgttcgacctgctggtcaagatgggctacaaggagatcgaggtcggcttcccg
gcctccggccagaccgacttcgacttcgtgcgctccatcatcgaggagcccggcgccatc
ccggacgacgtcaccatctccgtactgacccaggcccgcgaggacctgatcgagcgcacg
gtggagtccctgaagggcgcccggcgggccaccgtccacctgtacaacgccaccgccccg
gtcttccgccgggtcgtcttccgcggctcgcgcgacgacatcaagcagatcgcggtcgac
ggcacccgcctggtcatggagtacgccgagaagctgctgggcccggagacggagttcggc
taccagtactcgccggagatcttcaccgacaccgagctggacttcgccctggaggtctgc
gaggcggtgatggacacctaccagcccggccccggccgcgagatcatcctcaacctgccc
gccacggtggagcgttccacgccgtccacgcacgccgaccgcttcgagtggatgggccgc
aacctgtcccgccgcgagcacgtctgcctgtccgtccacccgcacaacgaccgcggtacg
gcggtggcggcggccgagctggcgctgatggccggcgccgaccgcatcgagggctgcctg
ttcggacagggcgagcgcaccggcaacgtcgacctggtcaccctgggcatgaacctgttc
tcccagggcgtcgacccgcagatcgacttctccgacatcgacgagatccgtcgcacgtgg
gagtactgcaaccagatggaggtccacccgcgccacccgtacgtgggcgacctggtctac
acgtccttctccggctcccaccaggacgccatcaagaagggcttcgacgccatggaggcc
gacgcggccgccaggggcgtcaccgtcgacgacatcgagtgggccgtcccgtacctgccc
atcgaccccaaggacgtcggccgctcctacgaggccgtcatccgcgtcaactcgcagtcc
ggcaagggcggcatcgcgtacgtcctgaagaacgaccacagcctggacctgccgcgccgg
atgcagatcgagttctcgaagctcatccaggccaagaccgacgccgagggcggcgagatc
acgccgaccgcgatctgggacgtcttccaggacgagtacctgcccaacccggacaacccc
tggggccgcatccaggtggccaacgggcagaccacgaccgaccgcgacggcgtcgacacc
ctcaccgtggacgccacggtcgacggtgcggagaccaccctggtcggcagcggcaacggc
ccgatctcggcgttcttccacgcactgcagggcgtcggcatcgacgtacggctgctggac
taccaggagcacacgatgagcgagggcgcctccgcgcaggccgcctcctacatcgagtgc
gcgatcggcgacaaggtgctgtggggcatcggaatcgacgcgaacaccacgcgcgcctcg
ctgaaggccgtcgtctccgccgtcaaccgcgcgactcgctga

DBGET integrated database retrieval system