KEGG   Streptomyces coelicolor: SCO2546Help
Entry
SCO2546           CDS       T00085                                 

Gene name
SCC77.13c
Definition
(RefSeq) adenosine deaminase
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO2546 (SCC77.13c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     SCO2546 (SCC77.13c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-GeneID: 1097980
NCBI-ProteinID: NP_626784
Kitasato: SCO2546
UniProt: Q9RDE5
Position
complement(2745002..2746024)
Genome map
AA seq 340 aa AA seqDB search
MKRPYDALMPLPKAELHLHIEGTLEPELAFALAARNGVSLPYADEDALREAYRFADLQSF
LNLYYELMAVLRTERDFEDLADAYLARAAAQGVRHAEIFFDPQAHLARGVEMGTVVEGLW
RALGASRENHGVSTRLILCFLRDESAESAMRTLDAAGPYLDRITGVGLDSAEVGHPPVKF
REVYEAAAALGLRRVAHAGEEGPPAYVVEALDVLGVERIDHGLRSVEDPALVERLVRERV
PLTLCPLSNVRLRTVDTLADHPLPAMLDAGLMCTVNSDDPAYFGGYAGDNFDAVRQALGL
TGERLRELARNSFLASFLEDDEELRARYLAEVEAYRFPAA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggccgtacgatgctctgatgcccctgcccaaagctgaactgcacctccacatc
gaaggcaccctggaaccggagctggccttcgcgctggccgcccgcaacggcgtgtccctg
ccgtacgcggacgaggacgccctgcgcgaggcgtaccgcttcgccgacctccagtccttc
ctgaacctgtactacgaactgatggccgtcctgcgcaccgagcgggacttcgaggacctc
gccgacgcctacctcgcccgcgccgccgcccagggcgtccggcacgccgagatcttcttc
gacccgcaggcccacctcgcccggggcgtggagatgggcacggtcgtagaagggctgtgg
cgggcactgggcgccagccgtgagaaccacggcgtctccacccggctgatcctctgcttc
ctgcgcgacgagtccgccgagtcggcgatgcggacgctggacgcggcggggccctacctc
gaccgcatcaccggcgtaggcctcgactccgccgaggtcggccacccgccggtcaagttc
cgcgaggtgtacgaggccgccgccgccctcggcctgcgccgggtcgcgcacgccggcgag
gagggcccgcccgcgtacgtcgtcgaggccctggacgtcctcggcgtggagcggatcgac
cacgggctgcgctcggtggaggacccggcgctggtcgagcggctggtgcgcgagcgcgtc
ccgctcactctgtgcccgctgtccaacgtgcgtctgcgcacggtcgacaccctcgccgac
cacccgctgcccgcgatgctcgacgcgggcctgatgtgcacggtgaactccgacgacccg
gcctacttcggcggctacgcgggcgacaacttcgacgccgtgcgccaggccctcggcctg
accggggagcggctgcgggagctggcccgcaactccttcctcgcctccttcctggaggac
gacgaggaactgcgggcgcggtacctcgcggaggtcgaggcgtaccggttccccgccgcg
tag

DBGET integrated database retrieval system