KEGG   Streptomyces coelicolor: SCO2585Help
Entry
SCO2585           CDS       T00085                                 

Gene name
proA
Definition
(RefSeq) gamma-glutamyl phosphate reductase
  KO
K00147  glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
sco  Streptomyces coelicolor
Pathway
sco00330  Arginine and proline metabolism
sco00332  Carbapenem biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SCO2585 (proA)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SCO2585 (proA)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     SCO2585 (proA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF3670
Motif
Other DBs
NCBI-GeneID: 1098019
NCBI-ProteinID: NP_626823
Kitasato: SCO2585
UniProt: Q9RDK1
Position
complement(2790362..2791648)
Genome map
AA seq 428 aa AA seqDB search
MTTLSPYDSMSPVTRAAYRAKSAAADLAPLPRAAKDDALLAVADALEVRTSEIVEANAQD
VAKARAAGTSEAIVDRLTLTPERVRAIASDVRDVVALPDPVGEIVRGSTLPNGIDLRQVR
VPLGVVGIIYEGRPNVTVDAAALCLKSGNAVLLRGSSSAYRSNTALVRVVRDAVGGAGLP
ADAVQLVPGESRESVRELMRARGLVDVLIPRGGASLISTVVQESTVPVIETGTGNCHVYV
DAHADLDMAVDILINSKAQRVGVCNAAETLLVHQDVAAEFLPRALAALAEAGVTVHADER
VMAHAKDSGANVVEATPEDWETEYLSYDIAAAVVDSLDRAVEHIRLWTSGHTEAIVTTSQ
QAARRFTQLVDSTTVAVNTSTRFTDGGQFGFGAEIGISTQKLHARGPMGLPELTSTKYIV
TGDGHVRR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctctcgccgtacgactcgatgtcaccggtcacccgggccgcctaccgggcc
aagtccgccgcggccgacctcgcgccgctgccgcgggcggccaaggacgacgcgctgctc
gccgtcgcggacgcgttggaggtccgtacgagcgagatcgtcgaggccaacgcccaggac
gtggccaaggcccgcgccgccgggaccagcgaggccatcgtcgaccgcctcacgctgacc
ccggagcgggtccgcgccatcgcctccgacgtgcgcgacgtggtcgcgctgcccgacccg
gtcggcgagatcgtgcgcggctccaccctccccaacggcatcgacctgcgccaggtccgg
gtgccactcggcgtggtcggcatcatctacgagggccggcccaacgtcacggtcgacgcc
gccgccctgtgcctgaagtccggcaacgcggtgctgctgcgcggctcctcctccgcctac
cggtcgaacaccgccctggtccgggtggtccgcgacgccgtgggcggggccgggctgccc
gccgacgccgtgcagctggtgcccggcgagagccgggagagcgtgcgcgagctgatgcgg
gcccgcggcctggtcgacgtgctcatcccgcgcggcggcgcctcgctgatcagcacggtc
gtccaggagtccaccgtccccgtcatcgagaccggcaccggcaactgccacgtctacgtc
gacgcgcacgccgacctcgacatggccgtcgacatcctgatcaactccaaggcccagcgc
gtcggcgtctgcaacgccgccgagaccctcctggtgcaccaggacgtcgccgccgagttc
ctgccccgcgcgctggccgcactcgcggaggccggggtcaccgtgcacgccgacgagcgg
gtgatggcccacgccaaggactccggcgcgaacgtcgtcgaggcgacccccgaggactgg
gagaccgagtacctgtcgtacgacatcgcggccgccgtcgtggactccctggaccgggcc
gtcgagcacatccggctgtggacctccggccacaccgaggccatcgtgaccacctcgcag
caggccgcccggcgcttcacccagctggtcgactccaccaccgtcgcggtgaacacctcc
acccgcttcaccgacggcggccagttcggcttcggcgccgagatcggcatctccacgcag
aagctgcacgcccggggccccatggggctgccggagctgaccagcacgaagtacatcgtc
accggcgacgggcacgtgcggcgctga

DBGET integrated database retrieval system