KEGG   Streptomyces coelicolor: SCO2612Help
Entry
SCO2612           CDS       T00085                                 

Gene name
ndk
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
sco_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO2612 (ndk)
   00240 Pyrimidine metabolism
    SCO2612 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sco04131]
    SCO2612 (ndk)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SCO2612 (ndk)
Membrane trafficking [BR:sco04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SCO2612 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 1098046
NCBI-ProteinID: NP_626849
Kitasato: SCO2612
UniProt: P50589
Position
complement(2836247..2836660)
Genome map
AA seq 137 aa AA seqDB search
MTQRSLVLLKPDAVRRGLTGEIISRIERKAGWQITALELRTLDTETLEQHYGEHKGKPFY
EPLVEFMASGPVVAMVVEGERVIEGVRALAGPTDPIAAAPGSIRGDYGVIVRENLIHASD
SEESAERELKIFFPGRV
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagcgcagcctcgtcctcctcaagcccgacgccgtccgtcgtggcctgaccggc
gagatcatcagccgcatcgagcgcaaggccggctggcagatcaccgcgctggaactgcgc
accctggacaccgagacgctggagcagcactacggcgagcacaagggcaagcccttctac
gagccgctggtcgagttcatggcctccgggccggtcgtggcgatggtcgtcgagggcgag
cgggtcatcgagggcgtgcgcgcgctggccggtccgaccgacccgatcgccgccgccccg
ggctccatccgcggggactacggcgtgatcgtccgcgagaacctgatccacgcctccgac
tccgaggagtccgccgagcgcgagctgaagatcttcttcccgggccgggtctga

DBGET integrated database retrieval system