KEGG   Streptomyces coelicolor: SCO2614Help
Entry
SCO2614           CDS       T00085                                 

Gene name
fpgS, SCC88.25c
Definition
(RefSeq) folylpolyglutamate synthase
  KO
K11754  dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
sco  Streptomyces coelicolor
Pathway
sco00790  Folate biosynthesis
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SCO2614 (fpgS)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     SCO2614 (fpgS)
    6.3.2.17  tetrahydrofolate synthase
     SCO2614 (fpgS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-GeneID: 1098048
NCBI-ProteinID: NP_626851
Kitasato: SCO2614
UniProt: Q9L1G4
Position
complement(2837148..2838482)
Genome map
AA seq 444 aa AA seqDB search
MDAALRAVETELAGRWGETKLEPSVTRIAALMDVLGEPQRSYPSIHITGTNGKTSTARMI
EALLGAFDLRTGRYTSPHVQSITERISLDGAPISAERFIETYEDIKPYVEMVDAQQEYRL
SFFEVLTGMAYAAFADAPVDVAVVEVGMGGSWDATNVIDGDVAVVTPIDLDHTDRLGGTP
GEIAVEKAGIVKQDATVILAQQPVDAAQVMLKKAVDVNATVAREGLEFGVVAREVAVGGQ
LATLRGLGGEYTEVYLPLHGAHQAHNAAVALAAVEAFFGVGAQRPEPLDVDTVRKAFASV
ASPGRMEVVRRSPTVVLDAAHNPAGARVTAEAVGEAFQFSRLIGVVGASADKNVRGLLEA
FEPVFAEVVVTQNSSHRAMDADELAAVAVEVFGDDRVQVEPRLPDALEAAITLAEEEGEF
AGGGVLVTGSVITVGEARLLLRRG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcggccctgcgcgccgtcgagacggagctggccggccgctggggcgagaccaag
ctggagccgtccgtcaccaggatcgccgcgctgatggacgtactgggcgagccgcagcgc
tcgtacccctccatccacatcaccgggaccaacggcaagacctccaccgcccgcatgatc
gaggccctgctcggcgccttcgatctgcgcaccgggcggtacacctcgccgcacgtgcag
tcgatcaccgagcggatcagcctggacggggcgccgatctccgccgagcggttcatcgag
acctacgaggacatcaagccgtacgtcgagatggtcgacgcgcagcaggagtaccggctg
tccttcttcgaggtgctgaccggcatggcgtacgccgccttcgccgacgcacccgtggac
gtggccgtcgtcgaggtcgggatgggcggctcctgggacgccaccaacgtcatcgacggg
gacgtggccgtcgtcacccccatcgacctggaccacaccgaccggctcggcgggacgccc
ggcgagatcgcggtcgagaaggccggcatcgtcaagcaggacgccaccgtcatcctggcc
cagcagccggtggacgcggcgcaggtgatgctgaagaaggccgtcgacgtcaacgccacc
gtggcccgcgaggggctggagttcggcgtcgtggcccgcgaggtcgccgtcggcgggcag
ctggccaccctgcgcggactgggcggcgagtacaccgaggtctacctgccgctgcacggc
gcccaccaggcgcacaacgcggcggtcgcgctggccgccgtcgaggcgttcttcggcgtc
ggcgcgcagcgtcccgagccgctggacgtcgacaccgtgcgcaaggccttcgcctccgtc
gcctcgccggggcggatggaggtggtgcggcgctcgccgaccgtggtcctcgacgccgcg
cacaacccggccggcgcccgggtcaccgccgaggcggtgggggaggccttccagttcagc
cgcctcatcggggtggtcggcgccagcgccgacaagaacgtgcgggggctcctcgaagcc
ttcgagccggtcttcgccgaggtcgtcgtcacccagaactccagccaccgcgcgatggac
gccgacgagctggccgcggtcgccgtcgaggtcttcggcgacgaccgcgtccaggtcgag
ccgcggctgccggacgccctggaggccgcgatcacgctggccgaggaggagggcgagttc
gccggcggcggtgtgctcgtcaccggttccgtcatcaccgtcggcgaggcccgactgctc
ctgaggaggggctga

DBGET integrated database retrieval system