KEGG   Streptomyces coelicolor: SCO2627Help
Entry
SCO2627           CDS       T00085                                 

Gene name
SC8E4.02c
Definition
(RefSeq) ribose-5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00051  Fructose and mannose metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sco_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO2627 (SC8E4.02c)
   00051 Fructose and mannose metabolism
    SCO2627 (SC8E4.02c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     SCO2627 (SC8E4.02c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-GeneID: 1098061
NCBI-ProteinID: NP_626863
Kitasato: SCO2627
UniProt: Q9L206
Position
complement(2854112..2854591)
Genome map
AA seq 159 aa AA seqDB search
MYLGSDHAGFELKNHLVEWLAAAGHEPVDCGPHIYDAQDDYPPFCLRAAERTAADQGALG
IVIGGSGNGEQIAANKVKGVRAALAWSEETASLGRQHNNANVVAVGARMHTQEEATKFVE
TFLGTPFSGDERHIRRIDMLTSYETTGDLPPVPSHHPQQ
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgtatctcggctcggaccatgcgggcttcgaactcaagaaccacctcgtcgagtggctc
gcggcggcgggacacgagcccgtcgactgcggtccgcacatctacgacgcccaggacgac
tacccgcccttctgcctgcgcgccgccgagcgcacggccgcggaccagggcgccctcggc
atcgtgatcggcggttccggcaacggcgagcagatcgcggcgaacaaggtgaagggcgtg
cgcgcggcgctggcctggagcgaggagacggcgtcgctgggccgccagcacaacaacgcc
aacgtcgtcgcggtcggcgcccgcatgcacacgcaggaggaggcgacgaagttcgtcgag
accttcctcggcaccccgttctccggcgacgaacgccacatccgccgcatcgacatgctc
acgtcctacgagacgacgggcgaccttcccccggtcccgtcccaccacccgcagcagtag

DBGET integrated database retrieval system