KEGG   Streptomyces coelicolor: SCO2640Help
Entry
SCO2640           CDS       T00085                                 

Gene name
asd1, SC8E4A.10
Definition
(RefSeq) aspartate-semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00261  Monobactam biosynthesis
sco00270  Cysteine and methionine metabolism
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
sco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
sco_M00033  Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO2640 (asd1)
   00270 Cysteine and methionine metabolism
    SCO2640 (asd1)
   00300 Lysine biosynthesis
    SCO2640 (asd1)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO2640 (asd1)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     SCO2640 (asd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh Gp_dh_C S4
Motif
Other DBs
NCBI-GeneID: 1098074
NCBI-ProteinID: NP_626876
Kitasato: SCO2640
UniProt: Q9L1Z5
Position
2870836..2871858
Genome map
AA seq 340 aa AA seqDB search
MRVGIVGATGQVGTVMRRILTERDFPVTELRLFASARSAGKELDGVTVEDAATADYSGLD
IVLFSAGGATSKALAEKVASQGPVVIDNSSAWRRDPEVPLVVSEVNPHAITDRPKGIIAN
PNCTTMAAMPVLRPLHAEAGLEAVVVATYQAVSGSGLAGVDELFEQVQKVGADAPKLTHD
GSAVEFPKPDKYVAPIAYNVLPLAGSIVDDGLHETDEEQKLRNESRKILEIPELKVSGTC
VRVPVFSGHSLQINARFARPISVERAKELLAGAPGVALTEVPTPLEAAGQDPSYVGRIRQ
DETVDNGLALFVSNDNLRKGAALNAVQIAELVAAELSAAK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgagggtcggaatcgtcggagccaccggtcaggtgggcacggtcatgcgcaggatcctc
acggagcgcgacttccccgtcaccgagctgcgcctgttcgcctcggcgcgcagcgccggc
aaggagctggacggcgtgacggtggaggacgcggccaccgccgactactccgggctggac
atcgtgctgttctcggcgggcggcgccacctccaaggcgctggccgaaaaggtcgcctcg
cagggccccgtcgtgatcgacaactcctccgcctggcgccgcgaccccgaggtcccgctg
gtggtctccgaggtgaacccgcacgcgatcaccgaccgccccaagggcatcatcgccaac
ccgaactgcaccacgatggccgcgatgccggtgctgcgcccgctgcacgcggaggcgggc
ctggaggcggtcgtcgtcgccacctaccaggcggtgtccggctccggcctggccggtgtg
gacgagctgttcgagcaggtccagaaggtcggcgcggacgcccccaagctgacccacgac
ggttcggcggtcgagttcccgaagccggacaagtacgtggcgcccatcgcgtacaacgtg
ctgccgctggccggttccatcgtcgacgacggcctgcacgagacggacgaggagcagaag
ctccgcaacgagtcccgcaagatcctggagatcccggagctgaaggtgtccggcacctgc
gtgcgcgtgcccgtcttcagcggccactccctgcagatcaacgcccgtttcgcccggccg
atcagcgtggagcgcgccaaggagctgctggccggagcccccggcgtggcgctcaccgag
gtgccgacgccgctggaggcggccggtcaggacccgtcgtacgtgggccggatccgccag
gacgagaccgtggacaacggcctcgccctgttcgtctccaacgacaacctccgcaagggc
gcggccctgaacgcggtgcagatcgcggagctggtcgcggccgagctgtccgccgccaag
tag

DBGET integrated database retrieval system