KEGG   Streptomyces coelicolor: SCO2661Help
Entry
SCO2661           CDS       T00085                                 

Gene name
SC6D10.04
Definition
(RefSeq) sugar hydrolase
  KO
K01222  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sco  Streptomyces coelicolor
Pathway
sco00010  Glycolysis / Gluconeogenesis
sco00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO2661 (SC6D10.04)
   00500 Starch and sucrose metabolism
    SCO2661 (SC6D10.04)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SCO2661 (SC6D10.04)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-GeneID: 1098095
NCBI-ProteinID: NP_626896
Kitasato: SCO2661
UniProt: Q9L260
Position
2892805..2894070
Genome map
AA seq 421 aa AA seqDB search
MKLTVVGGGSTYTPELIDGFARLRDTLPVEELVLVDPAADRLELVGGLARRIFTRQGHAG
RVVTTSDLDAAVDGADAVLLQLRVGGQAARQQDETWPLECGCVGQETTGAGGLAKALRTV
PVVLDIAERVRRANPDAWIIDFTNPVGIVTRALLQAGHRAVGLCNVAIGLQRKFAALLGV
APADVHLDHVGLNHLTWETGVRLGGPEGEDVLPRLLAEHGEAVAADLRLPRPLLDRLGVV
PSYYLRYYYAHDEVVDELRTKPSRAAEVAEMERQLLQMYGDPALDEKPALLAKRGGAYYS
EAAVDLAAALLGGAGSPYQVVNTYNRGTLPFLPDDAVIEVPAAVGGKGAAPLPVADVDPL
YAGLMANVTAYEDLALDAALRGGRDRVFRALLAHPLVGQYAYAEQLTDRLIAHNREHLAW
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaccgtggtcggcggcggttcgacctacacgcccgaactgatcgacggcttc
gcccggttgcgggacacgctgcccgtcgaggagctggtgctcgtcgatccggcggcggac
cggctggagctggtgggcggtctcgcccgccgcatcttcaccaggcaggggcacgccggc
cgcgtggtcaccacctccgacctggacgcggccgtcgacggcgccgacgccgtactgctc
cagctgcgggtcggcggacaggcggccaggcagcaggacgagacctggccgctggagtgc
ggctgcgtcgggcaggagacgaccggcgcgggcggtctcgccaaggcgctgcgcacggtg
ccggtggtgctggacatcgccgagcgggtgcgccgggccaacccggacgcctggatcatc
gacttcaccaacccggtcggcatcgtcacccgcgccctgctccaggccgggcaccgggcg
gtcggcctgtgcaacgtggcgatcgggctccagcgcaagttcgccgcgctgctcggggtg
gcaccggccgacgtccacctggaccacgtcggcctcaaccacctcacctgggagaccggc
gtacgcctcggcggccccgagggcgaggacgtgctgccccgcctgctggccgagcacggg
gaggccgtcgccgccgacctgcgcctgccccggccgctcctggaccggctgggcgtcgtc
ccctcctactacctgcgctactactacgcccacgacgaggtcgtcgacgagctgcgcacc
aagccgtcccgggccgccgaggtcgcggagatggaacggcaactgctgcagatgtacggc
gacccggccctggacgagaagcccgcgctgctcgccaagcgcggcggcgcctactactcc
gaggccgccgtcgacctcgccgccgccctgctcggcggcgcgggctccccgtaccaggtg
gtgaacacctacaaccggggcacgctgcccttcctccccgacgacgcggtgatcgaggtc
ccggcggcggtgggcggcaagggcgccgccccgctgccggtggcggacgtggacccgctg
tacgcggggctgatggcgaacgtgacggcgtacgaggacctggccctggacgcggccctg
cgcggcgggcgggaccgggtcttccgggcgctgctcgcccatcccctcgtcggccagtac
gcgtacgccgagcagctcaccgaccggctgatcgcacacaaccgggagcacctggcgtgg
gcctga

DBGET integrated database retrieval system