KEGG   Streptomyces coelicolor: SCO2687Help
Entry
SCO2687           CDS       T00085                                 

Gene name
ribA
Definition
(RefSeq) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
sco  Streptomyces coelicolor
Pathway
sco00740  Riboflavin metabolism
sco00790  Folate biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO2687 (ribA)
   00790 Folate biosynthesis
    SCO2687 (ribA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SCO2687 (ribA)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SCO2687 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-GeneID: 1098121
NCBI-ProteinID: NP_626921
Kitasato: SCO2687
UniProt: Q9KYI5
Position
2931148..2931792
Genome map
AA seq 214 aa AA seqDB search
MRTEENEDVIVAPSPAVQVRARVEVPIDVPGLGPRASTMVSFDGLHDGREHVALLMPGWE
KKSDPLVRVHSECLTGDVFGSQRCDCGPQLHEALAMCSHEGGIILYLRQEGRGIGLYNKF
DAYLLQDGGLDTFEANAVLNFSHDLRDYRVAAEMLSALGVPRIRLLSNNPEKGNQLRSHG
VVISDVVATGTFVNENNQAYLTAKRERAGHALEV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccgaagagaacgaagacgtgatcgtcgcaccctcccccgccgtgcaggtgagg
gcccgggtggaagtccccatcgatgtccccggcctgggaccccgggcgagcaccatggtc
agtttcgacggactgcacgacggtcgcgagcacgtcgcgctccttatgccgggctgggaa
aagaagagcgatccactggtgcgggttcattccgaatgcctcaccggtgacgtcttcgga
tctcagcgctgcgactgcggtccccaacttcacgaggcactcgccatgtgctcccacgaa
ggcggcatcatcctgtatctgcgacaggaggggcgcggtatcgggctgtacaacaagttc
gacgcctacctgctgcaggacgggggcctggacaccttcgaagcgaatgcagtgctcaat
ttcagccatgatctgcgggactaccgggtggcggccgagatgctgagcgctctgggcgtg
cccagaatccgtctgctgtccaacaacccggagaagggaaaccagctccgttcgcacggc
gttgtcatatcggacgtcgtcgcgacggggaccttcgtcaatgagaacaaccaggcctac
ctgacggccaagcgcgaacgagccggtcatgcactcgaggtctga

DBGET integrated database retrieval system