KEGG   Streptomyces coelicolor: SCO2736Help
Entry
SCO2736           CDS       T00085                                 

Gene name
gltA
Definition
(RefSeq) type II citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00020  Citrate cycle (TCA cycle)
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sco_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sco_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCO2736 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2736 (gltA)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SCO2736 (gltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-GeneID: 1098170
NCBI-ProteinID: NP_626968
Kitasato: SCO2736
UniProt: Q9R339
Position
complement(2982769..2984058)
Genome map
AA seq 429 aa AA seqDB search
MSDNSVVLRYGDGEYTYPVIDSTVGDKGFDIGKLRAQTGLVTLDSGYGNTAAYKSAITYL
DGEAGILRYRGYPIEQLAERSSFVEVAYLLINGELPTVDELSAFKGEITQHTLLHEDVKN
FYKGFPRDAHPMAMLSSVVSALSTFYQDSHNPFDERQRNLSTIRLLAKLPTIAAYAYKKS
IGHPFVYPANNLGYVENFLRMTFSVPAQEYELDPTVVAALDKLLILHADHEQNCSTSTVR
LVGSSQANMFASISAGINALWGPLHGGANQSVLEMLEGIRDAGGDVDSFIRKVKNKEDGV
RLMGFGHRVYKNFDPRAKIIKAAAHDVLSALGKSDELLDIALKLEEHALSDDYFVSRSLY
PNVDFYTGLIYRAMGFPTEMFTVLFALGRLPGWIAQWHEMIKEPGSRIGRPRQIYTGVVE
RDFVPVEER
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacaactctgtagtactgcggtacggcgacggcgagtacacctacccggtgatc
gacagcaccgtcggtgacaagggcttcgacatcgggaagctccgcgcccagaccggtctg
gtgacgctggacagcggttacggcaacaccgccgcctacaaatccgccattacctatctg
gacggcgaagccggcatcctccggtaccgcggctacccgatcgagcagctggccgagcgc
tcctccttcgtggaggtggcctacctgctgatcaacggcgagctgccgacggtcgacgag
ctgtccgcgttcaagggcgagatcacgcagcacaccctgctgcacgaggacgtcaagaac
ttctacaagggcttcccgcgcgacgcccacccgatggccatgctgtcgtcggtggtctcg
gcgctgtccaccttctaccaggacagccacaacccgttcgacgagcggcagcgcaacctc
tccacgatccggctgctcgcgaagcttccgacgatcgcggcgtacgcgtacaagaagtcg
atcggccacccgttcgtctacccggccaacaacctcggctacgtcgagaacttcctgcgc
atgaccttctcggttccggcgcaggagtacgagctggacccgacggtcgtcgcggccctc
gacaagctgctgatcctgcacgcggaccacgagcagaactgctcgacctccacggtgcgc
ctggtcggctcctcgcaggcgaacatgttcgcctcgatctccgccggcatcaacgccctg
tggggcccgctgcacggcggcgccaaccagtcggtgctggagatgctggaaggcatccgc
gacgcgggcggcgacgtcgactccttcatccgcaaggtgaagaacaaggaggacggcgtc
cgcctgatgggcttcggccaccgggtctacaagaacttcgacccgcgcgccaagatcatc
aaggccgccgcgcacgacgtgctctccgcgctcggcaagtccgacgagctgctggacatc
gcgctgaagctggaggagcacgcgctctccgacgactacttcgtctcgcgcagcctctac
ccgaacgtcgacttctacaccggtctgatctaccgggccatgggcttcccgaccgagatg
ttcacggtcctgttcgccctcggccggctgccgggctggatcgcccagtggcacgagatg
atcaaggagccgggttcccgcatcggccgcccgcgccagatctacacgggcgtcgtcgag
cgcgacttcgtccccgtcgaggagcgctga

DBGET integrated database retrieval system