KEGG   Streptomyces coelicolor: SCO2769Help
Entry
SCO2769           CDS       T00085                                 

Gene name
SCC57A.40c
Definition
(RefSeq) acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00290  Valine, leucine and isoleucine biosynthesis
sco00650  Butanoate metabolism
sco00660  C5-Branched dibasic acid metabolism
sco00770  Pantothenate and CoA biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
sco01210  2-Oxocarboxylic acid metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sco_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO2769 (SCC57A.40c)
   00660 C5-Branched dibasic acid metabolism
    SCO2769 (SCC57A.40c)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO2769 (SCC57A.40c)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO2769 (SCC57A.40c)
Enzymes [BR:sco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SCO2769 (SCC57A.40c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M XFP_N TPP_enzyme_M_2
Motif
Other DBs
NCBI-GeneID: 1098203
NCBI-ProteinID: NP_627000
Kitasato: SCO2769
UniProt: Q9RDF9
Position
complement(3019967..3021661)
Genome map
AA seq 564 aa AA seqDB search
MTHDHDLVLRPTPAQTEAALNPPPGRTGGDLVVESLAALGATTVFGLPGQHALGVFDALR
RSDLRYIGLRVENNAGFAADAYGRITGEAAPLLLSTGPGALTSLAALQEARAASAPVLAI
GSQVPAAGLGGGRHGYLHELPDQAASFRGVVKSVHTARTQSQIPSAIAEAWTSALTVPHG
PVWVEIPQDVLLAETAIPVVTGGDTFPEELPPRPELTAVAADLLTRAERPAIIAGGGVVR
ADAAKKLRQLAERLQAPVVTTFGGKGAFPWTHPLSLQSWLEDRHTTDFLEDADVLLVIGS
GLGELSSNYHTFTPRGRVIQIEADLGKLESNHPALGIHADARLALQALLETVEEPRTDPT
APERVREVLDKVRARVAAQELTLEQDVLAAVRKALPSRAPSFWDMTILAYWAWSAFDPGA
PNTMHSAQGAGGLGYAFPAALGAAAADPTHPVLAVSGDGGALYSIAELATARQYGLNVTW
LIVDDGGYGILRAYMTDAFGTPTATATDLPGPDFVALAESFGVPGVRTSPETLARDLAKA
LATPGPSVVVLPAVLRMFAPTHAD
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacgaccatgacctggtgctccgtccgaccccggcccagacggaggccgcgctg
aatcctccccccggccgcaccggcggggacctggtcgtggagtccctggccgcgctcggc
gcgaccaccgtcttcggcctgcccggccagcacgccctcggcgtgttcgacgccctgcgc
cgctccgacctgcgctacatcggcctgcgggtggagaacaacgccgggttcgccgccgac
gcctacggccggatcaccggcgaagcggccccgctgctgctgtccaccggtccgggagcc
ctcacctccctggccgcgctccaggaggcgcgggcagcctccgcgcccgtcctggcgatc
ggcagccaggtccccgcggcgggcctcggcggcggccgccacggctacctgcacgaactc
cccgaccaggccgcgtccttccgcggcgtggtcaagtccgtgcacaccgcccgcacccag
tcccagatcccgtccgcgatcgcggaggcctggacgtcggcactgaccgtcccgcacggc
ccggtgtgggtggagatcccgcaggacgtcctcctggccgagacggccatcccggttgtg
accggcggcgacaccttccccgaggaactgcccccgcgccccgaactgacggccgtcgcc
gccgacctgctcacccgcgccgagcgcccggcgatcatcgcgggcgggggagtggtccgc
gcggacgccgccaagaagctgcggcagctcgcggagcggctccaggcccccgtcgtcacg
accttcggcggcaagggcgccttcccctggacgcaccccctctccctccagtcctggctg
gaggaccgccacacgacggacttcctggaggacgccgacgtcctcctcgtgatcggctcg
ggcctcggcgaactctcctcgaactaccacacgttcaccccccgcggccgggtgatccag
atcgaggccgacctcggcaagctggagtccaaccacccggccctcggcatccacgccgac
gcccgcctcgccctccaggcgctgctggagacggtggaggagccgcgcacggacccgacc
gccccggaacgcgtccgcgaggtcctggacaaggtccgcgcacgcgtcgccgcccaggaa
ctcaccctggagcaggacgtcctggccgccgtccgcaaggccctcccgtcccgtgccccc
tccttctgggacatgaccatcctggcctactgggcgtggtcggccttcgaccccggggcc
ccgaacaccatgcactccgcccagggcgccggcggcctcggctacgccttcccggcggcc
ctgggcgccgcggcggccgaccccacccacccggtgcttgcggtctccggcgacggcggc
gccctgtactcgatcgccgagctggccaccgcccgccagtacggcctgaacgtcacctgg
ctcatcgtcgacgacggcggctacggcatcctgcgcgcgtacatgaccgacgccttcggc
actccgacggccacggcgacggacctgccgggccccgacttcgtcgccctggccgagtcg
ttcggagtccccggcgtacgcaccagccccgagaccctggcacgcgacctcgcgaaggca
ctggcgacgccgggcccgtcggtcgtcgtactccccgccgtcctgaggatgttcgcgccg
acgcacgcggactga

DBGET integrated database retrieval system