KEGG   Streptomyces coelicolor: SCO2777Help
Entry
SCO2777           CDS       T00085                                 

Gene name
accC, SCC105.08
Definition
(RefSeq) acetyl/propionyl CoA carboxylase subunit alpha
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
sco  Streptomyces coelicolor
Pathway
sco00061  Fatty acid biosynthesis
sco00280  Valine, leucine and isoleucine degradation
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01212  Fatty acid metabolism
Module
sco_M00082  Fatty acid biosynthesis, initiation
sco_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO2777 (accC)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2777 (accC)
   00640 Propanoate metabolism
    SCO2777 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SCO2777 (accC)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO2777 (accC)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SCO2777 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SCO2777 (accC)
    6.4.1.3  propionyl-CoA carboxylase
     SCO2777 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C HlyD_3 Biotin_lipoyl_2 ATP-grasp HlyD_D23 ATP-grasp_3 RnfC_N GCV_H NQRA
Motif
Other DBs
NCBI-GeneID: 1098211
NCBI-ProteinID: NP_627007
Kitasato: SCO2777
UniProt: Q9L076
Position
3029169..3031109
Genome map
AA seq 646 aa AA seqDB search
MFDTVLVANRGEIAVRVIRTLRSMGVRSVAVFSDADADARHVREADDAVRIGPAPATESY
LSVERLLAAAARTGAQAVHPGYGFLAENAGFARACEEAGLVFIGPSADAIALMGDKIRAK
ETVRAAGVPVVPGSSGSGLTDEQLADAAREIGTPVLLKPSAGGGGKGMRLVRDTAVLADE
IAAARREARASFGDDTLLVERWIDRPRHIEIQVLADGHGGVVHLGERECSLQRRHQKVIE
EAPSVLLDEATRAAMGEAAVQAARSCGYRGAGTVEFIVPGSDPSQYYFMEMNTRLQVEHP
VTELVTGLDLVEWQLRVAAGEPLGFGQEDVRLTGHAIEARLCAEDPARGFLPSGGTVLRL
REPEGDGVRTDSGLSEGTEVGSLYDPMLSKVIAYGPDRETALRRLRAALAGTVTLGVQTN
AGFLRRLLAHPAVVAGELDTGLVEREVDGLVATDVPEEVYEAAAAVRLEALRPRGDGWTD
PFSVPSGWRMGGEPKAAAFHLRVTDPVEHTPRGTHTVTGDRVTVTLDGVRHTFHRAADWL
GRDGDAWQVRDHDPVAASLNRSAHAGADSLTAPMPGTVTVVKVAVGDEVSAGQSLLVVEA
MKMEHVISAPHAGTVAELDVAPGTTVAMDQVLAVIAPTDDATEETA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaccgtgctcgtcgccaaccgcggcgagatcgccgtccgcgtcatccggacg
ctgcgctcgatgggcgtgcgctcggtggcggtcttctccgacgccgacgcggacgcacgg
cacgtgcgggaggcggacgacgcggtacggatcggcccggcgcccgcgacggagagctat
ctgtccgtcgagcggctgctggcggcggcggcccggacgggggcgcaggccgtccacccg
ggatacggcttcctcgccgagaacgcgggtttcgcgcgggcctgcgaggaggcggggctg
gtcttcatcgggccgtccgccgacgcgatcgccctgatgggcgacaagatccgcgccaag
gagacggtgcgggcggccggggtgccggtcgtccccggctccagcggcagcgggctcacc
gacgagcagctcgccgacgccgcccgcgagatcggcaccccggtgctgctcaagccgtcg
gcgggcggtggcggcaagggcatgcggctggtgcgggacacggcggtgctggccgacgag
atcgccgccgcgcgccgcgaggcccgcgcctccttcggcgacgacacgctgctggtggag
cggtggatcgaccgtccccggcacatcgagatccaggtgctggccgacggccacgggggc
gtggtgcacctgggcgagcgcgagtgctcgctccagcgccgccaccagaaggtgatcgag
gaggcgcccagcgtcctgctggacgaggcgacccgggcggcgatgggcgaggcggccgtg
caggcggcccggtcctgcggctaccggggcgcgggcacggtggagttcatcgtgcccggg
agcgacccctcccagtactacttcatggagatgaacacccgtctccaggtcgagcacccg
gtgacggagctggtgaccggcctggacctggtggagtggcagctgcgggtggcggcgggc
gagccgctcgggttcgggcaggaggacgtacggctgaccgggcacgcgatcgaggcccgg
ctgtgcgcggaggacccggcgcgcggcttcctgccctccggcggcacggtgctgcggctg
cgcgagcccgagggcgacggcgtgcgcaccgactcggggctcagtgagggcaccgaggtc
ggcagcctctacgacccgatgctgtccaaggtgatcgcgtacggccccgaccgggagacc
gcgctgcgcaggctccgggcggcgctggccgggacggtcaccctgggcgtgcagaccaac
gccgggttcctgcggcggctgctcgcgcacccggcggtggtggcgggcgagctggacacg
gggctggtggagcgcgaggtcgacggcctggtcgccaccgacgtaccggaggaggtgtac
gaggcggcggcggccgtacggctggaggcgctgcgcccgcgcggggacggctggacggac
ccgttctcggtgccgagcggctggcggatgggcggcgagccgaaggcggccgccttccac
ctccgggtcaccgacccggtggaacacaccccgcgcggaacccacaccgtcaccggggac
cgggtcacggtcaccctggacggcgtccggcacaccttccaccgcgccgccgactggctg
ggccgcgacggcgacgcctggcaggtgcgcgaccacgacccggtggccgcctccctcaac
cggtccgcccacgcgggcgccgactcgctgaccgcgccgatgccgggcacggtgacggtg
gtgaaggtcgccgtcggcgacgaggtgagcgccgggcagagcctgctggtggtggaggcg
atgaagatggagcacgtcatctccgccccgcacgcgggcaccgtcgccgagctggacgtg
gcgccgggcacgacggtcgccatggaccaggtgctcgcggtcatcgcacccaccgacgac
gcgacggaggagacggcatga

DBGET integrated database retrieval system