KEGG   Streptomyces coelicolor: SCO2778Help
Entry
SCO2778           CDS       T00085                                 

Gene name
hmgL, SCC105.09
Definition
(RefSeq) hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00072  Synthesis and degradation of ketone bodies
sco00280  Valine, leucine and isoleucine degradation
sco00281  Geraniol degradation
sco00650  Butanoate metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO2778 (hmgL)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SCO2778 (hmgL)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO2778 (hmgL)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SCO2778 (hmgL)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     SCO2778 (hmgL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-GeneID: 1098212
NCBI-ProteinID: NP_627008
Kitasato: SCO2778
UniProt: Q9L075
Position
3031106..3032059
Genome map
AA seq 317 aa AA seqDB search
MNAPEPGLPMAVPAEGLPARVRIHEVGARDGLQNEKATVPTAVKAEFIRRLAGTGLTTIE
ATSFVHPKWVPQLADAEDLYPRISGLPVELPVLVPNERGLDRALALGARRVAVFASATES
FAKANLNRTVDEALAMFEPVVTRAKAQGDDVRVRGYLSMCFGDPWEGPVAVPQVVRVCRA
LLDMGCDELSLGDTIGVATPGHVTALLTALTGAGVPVSALGVHFHDTYGQALANTLAALQ
RGVTTVDASAGGLGGCPFAKSATGNLATEDLVWMLRGLGIDTGVDLGRLVATSVWMAAHL
GRPSPSRTVRALSHQES
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccccggaaccgggcctcccgatggccgtaccggccgagggactgcccgcccgc
gtccgcatccacgaggtcggcgcgcgcgacggactgcagaacgagaaggcgaccgtgccg
acggccgtcaaggcggagttcatccgccggctggccggcacgggcctgaccacgatcgag
gcgacgagcttcgtccaccccaagtgggtcccccagctggccgacgccgaggacctgtac
ccgcggatctccggcctgccggtggagctgccggtgctggtgccgaacgaacgcggcctg
gaccgggccctcgcgctcggcgcgcgccgggtcgcggtgttcgccagcgcgaccgagtcc
ttcgccaaggccaacctcaaccgcaccgtggacgaggcgctggccatgttcgagcccgtg
gtgacccgggcgaaggcgcagggcgacgacgtccgtgtacggggctacctctcgatgtgc
ttcggcgatccgtgggagggcccggtcgccgtcccccaggtggtgcgggtctgccgggcc
ctgctggacatgggctgcgacgagctgagcctcggcgacaccatcggggtggcgaccccg
ggccatgtgacggcgctgctcaccgcgctgaccggggcgggcgtgccggtctccgcgctg
ggcgtgcacttccacgacacctacggccaggccctggccaacacgctggccgcgctccag
cggggcgtcaccaccgtcgacgcctccgccggcgggctcggcggctgccccttcgcgaag
tccgccaccggcaacctcgccaccgaagacctcgtgtggatgctgcggggcctcggcatc
gacaccggggtcgacctcggccgtctcgtcgccacaagcgtctggatggccgcgcacctg
ggccggccgagcccgtcccgcaccgtacgagccctctcccaccaggagtcgtga

DBGET integrated database retrieval system