KEGG   Streptomyces coelicolor: SCO2789Help
Entry
SCO2789           CDS       T00085                                 

Gene name
glmS2, SCC105.20
Definition
(RefSeq) glucosamine-fructose-6-phosphate aminotransferase
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sco  Streptomyces coelicolor
Pathway
sco00250  Alanine, aspartate and glutamate metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCO2789 (glmS2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO2789 (glmS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sco01002]
    SCO2789 (glmS2)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     SCO2789 (glmS2)
Peptidases [BR:sco01002]
 Cysteine Peptidases
  Family C44
   SCO2789 (glmS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 SIS_2
Motif
Other DBs
NCBI-GeneID: 1098223
NCBI-ProteinID: NP_627019
Kitasato: SCO2789
UniProt: Q9L065
Position
3043786..3045603
Genome map
AA seq 605 aa AA seqDB search
MCGIVGYIGKRDVAPLLLEGLQRLEYRGYDSAGIVVTSPKAAGLRMVKAKGRVRDLEAKV
PARFKGTTGIAHTRWATHGAPSDVNAHPHMSADNKVAVVHNGIIDNAADLRRKLEADGVE
FLSETDTEVLVHLIARSEAEKLEDKVRETLRVIEGTYGIAVMHADFPERIVVARNGSPVV
LGIGEKEMFVASDIAALVAHTRQIVTLDDGEMATLKADDFRTYTTEGTRTTSEPTTVEWE
AASYDMGGHDTYMHKEIHEQAEAVDRVLRGRIDDRFSTVHLGGLNLDARDARAVRRVKIL
GCGTSYHAGQIGAQMIEELARIPADAEPASEFRYRNAVVDPDTLYIAVSQSGETYDVLAA
VQELKRKGARVLGIVNVVGSAIAREADGGMYVHAGPEVCVVSTKCFTNTCVAFALLALHL
GRTRDLSVRDGKRIIEGLRKLPAQIEEMLKQEEDVKKLAAQYAEARSMLFIGRVRGYPVA
REASLKLKEVSYIHAEAYPASELKHGPLALIEPALPTVAIVPDDDLLEKNRAALEEIKAR
SGQILAVAHQEQEKADHTIVVPKNEDELDPILMGIPLQLLAYHTALALGRDIDKPRNLAK
SVTVE
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtcggatacatcggcaagcgtgacgtcgcccccctgctcctggagggt
ctccagcgcctggagtaccgcgggtacgactcggcgggcatcgtggtgacctccccgaag
gcggccggcctgaggatggtcaaggccaagggccgggtgcgcgacctggaggccaaggtc
ccggcgcgcttcaagggcaccaccggcatcgcccacacccgctgggccacccacggcgcc
ccctccgacgtgaacgcccacccgcacatgtcggccgacaacaaggtcgccgtcgtccac
aacggcatcatcgacaacgccgccgacctgcgccgcaagctggaggcggacggcgtcgag
ttcctctccgagaccgacaccgaggtcctcgtccacctcatcgcccgctccgaggcggag
aagctggaggacaaggtccgcgagaccctgcgggtcatcgagggcacgtacggcatcgcc
gtgatgcacgccgacttccccgaacgcatcgtggtcgcccgcaacggctcgccggtcgtc
ctcggcatcggcgagaaggagatgttcgtcgcctcggacatcgccgcgctggtcgcccac
acccggcagatagtcacgctcgacgacggcgagatggccaccctcaaggccgacgacttc
cgcacctacaccaccgagggcacccgcaccacgtcggagcccaccaccgtggagtgggag
gccgcctcctacgacatgggcggccacgacacctacatgcacaaggagatccacgagcag
gccgaggccgtggaccgcgtgctgcgcggccggatcgacgaccgcttctccaccgtgcac
ctcggcggcctcaacctggacgcccgcgacgcgcgcgccgtgcgccgcgtgaagatcctg
ggctgcggcacctcgtaccacgcgggccagatcggcgcccagatgatcgaggagctggcc
cgcatccccgcggacgccgagccggcctccgagttccgctaccgcaacgcggtcgtcgac
cccgacaccctgtacatcgccgtctcccagtccggcgagacctacgacgtgctggccgcc
gtgcaggagctgaagcgcaagggcgcccgcgtcctcggcatcgtcaacgtcgtgggctcg
gcgatcgcccgcgaggccgacggcgggatgtacgtgcacgccggccccgaggtctgcgtg
gtgtcgaccaagtgcttcaccaacacctgcgtcgccttcgcgctgctcgccctgcacctg
ggccgcacccgcgacctctccgtccgcgacggcaagcggatcatcgaggggttgcgcaag
ctgcccgcgcagatcgaggagatgctgaagcaggaggaggacgtcaagaagctggccgcg
cagtacgccgaggcccgctcgatgctcttcatcggccgggtgcggggctacccggtcgcc
cgcgaggcctccctgaagctcaaggaggtctcctacatccacgccgaggcctacccggcc
tccgagctgaagcacggcccgctcgccctgatcgagccggccctgccgaccgtcgcgatc
gtgccggacgacgacctgctggagaagaaccgcgcggccctggaggagatcaaggcccgc
agcggtcagatcctcgctgtggcccaccaggagcaggagaaggccgaccacacgatcgtc
gtcccgaagaacgaggacgagctggacccgatcctcatgggcatcccgctccagctcctc
gcgtaccacacggctctggccctgggccgggacatcgacaagccccgcaacctcgccaag
tccgtgacggtggagtag

DBGET integrated database retrieval system