KEGG   Streptomyces coelicolor: SCO2794
Entry
SCO2794           CDS       T00085                                 
Symbol
2SCC13.02c
Name
(RefSeq) LacI family transcriptional regulator
Organism
sco  Streptomyces coelicolor
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_31 Sigma70_r4 TetR_N DUF2277 HTH_IclR
Other DBs
NCBI-GeneID: 1098228
Kitasato: SCO2794
UniProt: Q9F3I7
Position
complement(3049837..3050892)
AA seq 351 aa
MASHGVRGRSGGRPTLEEVAARAGVGRGTVSRVINGSPRVSDATRAAVEAAVAELGYVPN
TAARALAANRTDAIALVVPEPETRFFAEPYFSDMLKGVGSELSETEMQLLLIFAGSDRER
ERLAQYLAAHRVDGVLLVSVHADDPLPDLLTQLEIPAVISGPRSAAEPLASVDSDNYGGA
RSAVEHLLSRGRGRVAHITGHLAVYGAQRRVDGYRDALREAGHEVDEGLIEPGDFTEEGG
RRAMAELLRRHPDVDAVFAASDVTAAGAGQVLREAGRRIPDDVALVGYDDSAIARHMEPP
LTSVRQPIEEMGRAMIDLLLTEIADRRPAASRGLERHQVVLATELVERRSS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcaagccacggagtgcgtggtcggagcggtggccggcccaccctcgaagaggtggcg
gcacgcgcgggcgtcggccgcggcacggtctcccgcgtgatcaacggctcgccgcgggtc
agcgacgcgacccgggcggccgtcgaggcggcggtcgcggaactcgggtacgtcccgaac
acggcggcccgagcgctggcggccaaccgcacggacgcgatcgccctggtggtgccggag
ccggagacgcggttcttcgcggagccgtacttctcggacatgctgaagggcgtcggctcc
gagctgtccgagaccgagatgcagctgctgctgatattcgcgggcagcgaccgggagcgg
gagcggctcgcccagtatctggcggcgcaccgggtggacggcgtcctgctggtctcggtg
cacgccgacgacccgctgcccgacctgctgacccagctggagatccccgcggtgatcagc
ggcccgcgctcggccgcggaaccgctggcgtcggtggactcggacaactatggcggcgcc
cgctcggccgtcgagcacctgctgtcccgagggcgcggccgcgtcgcccacatcaccggt
cacctcgccgtctacggcgcgcagcgacgcgtcgacggctaccgcgacgccctgcgcgag
gcgggccacgaggtggacgagggactgatcgagccgggcgacttcaccgaggagggcgga
cgccgcgcgatggcggagctgctgcgccgccaccccgacgtggacgcggtcttcgccgcc
tccgacgtcaccgcggcgggcgccgggcaggtcctgcgcgaggcgggccggcgcatcccg
gacgacgtggcgctggtcggctacgacgactcggccatcgcccgccacatggagccgccg
ctgaccagcgtgcgccagcccatcgaggagatgggccgcgcgatgatcgacctgctgctg
accgagatcgccgaccgccgcccggccgcctcgcgcggcctggaacgccaccaggtggtg
ctggcgacggaactggtggagcgcaggtcgtcgtaa

DBGET integrated database retrieval system