KEGG   Streptomyces coelicolor: SCO2797Help
Entry
SCO2797           CDS       T00085                                 

Gene name
2SCC13.05
Definition
(RefSeq) cellobiose transport permease
  KO
K10242  cellobiose transport system permease protein
Organism
sco  Streptomyces coelicolor
Pathway
sco02010  ABC transporters
Module
sco_M00206  Cellobiose transport system
Brite
KEGG Orthology (KO) [BR:sco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SCO2797 (2SCC13.05)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO2797 (2SCC13.05)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Cellobiose transporter [MD:M00206] [OT]
    SCO2797 (2SCC13.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 1098231
NCBI-ProteinID: NP_627027
Kitasato: SCO2797
UniProt: Q9F3I4
Position
3053615..3054526
Genome map
AA seq 303 aa AA seqDB search
MTTTMTKPPADAAPEPPRRGRRRSKASRAGGTLHAGPVAYIILALFTIGSLFPLVWTAIA
ASRDNQRLAQTPPPLWFGGNLFDKLEIAWNDANLGEAFLNTTIVAGISACTIVFLSTVAG
FAFAKLRFRGRNALMLIVVGTMMVPPQLSIIPLYMMVAKLDWSDQLQAVILPSLVNAFGV
FFMRQYLLQALPDEIIEAARVDGASSWRVMWHVVFPAARPAMAVLGMLMFVQSWNDFLWP
FLVLTQNGSPTVQVALAGLGRGYTPDQSLIMAGALLGTLPLLLVFAIFGKQIVGGIMQGA
VKG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgaccatgacgaaacccccggccgacgcggcacccgagccgccccggcggggc
cgacgacgttccaaggcatcccgggccggtggcacgctgcacgccgggccggtcgcctac
atcatcctcgccctgttcaccatcggctcgctgttcccgctggtgtggacggcgatcgcc
gcctcgcgcgacaaccagcggctcgcccagacaccgccgcccctctggttcggcggcaac
ctgttcgacaagctcgagatcgcctggaacgacgccaacctcggcgaggcgttcctcaac
accaccatcgtggccgggatctcggcgtgcaccatcgtcttcctgtcgacggtcgccggg
ttcgccttcgccaagctgcgcttccgcgggcgcaacgcgctgatgctgatcgtcgtcggc
acgatgatggtgccgccgcagctcagcatcatcccgctgtacatgatggtcgcgaagctg
gactggtccgaccagttgcaggcggtgatcctgccgtccctggtgaacgcgttcggcgtg
ttcttcatgcggcagtacctgctccaggcgctgcccgacgagatcatcgaggccgcgcgc
gtggacggcgccagcagctggcgtgtgatgtggcacgtggtgttcccggcggcgcggccc
gcgatggccgtgctcggcatgctgatgttcgtgcagtcctggaacgacttcctgtggccg
ttcctggtgctgacgcagaacggcagcccgaccgtgcaggtcgcactcgccggactgggc
cgcggctacaccccggaccagtccctgatcatggccggtgcgctgctgggcacgctgccg
ctgctgctggtgttcgcgatcttcggcaagcagatcgtgggcggcatcatgcagggcgcc
gtcaagggctga

DBGET integrated database retrieval system