KEGG   Streptomyces coelicolor: SCO2797Help
Entry
SCO2797           CDS       T00085                                 

Gene name
2SCC13.05
Definition
(RefSeq) cellobiose transport permease
  KO
K10242  cellobiose transport system permease protein
Organism
sco  Streptomyces coelicolor
Pathway
sco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SCO2797 (2SCC13.05)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sco02000]
    SCO2797 (2SCC13.05)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Cellobiose transporter
    SCO2797 (2SCC13.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 1098231
NCBI-ProteinID: NP_627027
Kitasato: SCO2797
UniProt: Q9F3I4
Position
3053615..3054526
Genome map
AA seq 303 aa AA seqDB search
MTTTMTKPPADAAPEPPRRGRRRSKASRAGGTLHAGPVAYIILALFTIGSLFPLVWTAIA
ASRDNQRLAQTPPPLWFGGNLFDKLEIAWNDANLGEAFLNTTIVAGISACTIVFLSTVAG
FAFAKLRFRGRNALMLIVVGTMMVPPQLSIIPLYMMVAKLDWSDQLQAVILPSLVNAFGV
FFMRQYLLQALPDEIIEAARVDGASSWRVMWHVVFPAARPAMAVLGMLMFVQSWNDFLWP
FLVLTQNGSPTVQVALAGLGRGYTPDQSLIMAGALLGTLPLLLVFAIFGKQIVGGIMQGA
VKG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgaccatgacgaaacccccggccgacgcggcacccgagccgccccggcggggc
cgacgacgttccaaggcatcccgggccggtggcacgctgcacgccgggccggtcgcctac
atcatcctcgccctgttcaccatcggctcgctgttcccgctggtgtggacggcgatcgcc
gcctcgcgcgacaaccagcggctcgcccagacaccgccgcccctctggttcggcggcaac
ctgttcgacaagctcgagatcgcctggaacgacgccaacctcggcgaggcgttcctcaac
accaccatcgtggccgggatctcggcgtgcaccatcgtcttcctgtcgacggtcgccggg
ttcgccttcgccaagctgcgcttccgcgggcgcaacgcgctgatgctgatcgtcgtcggc
acgatgatggtgccgccgcagctcagcatcatcccgctgtacatgatggtcgcgaagctg
gactggtccgaccagttgcaggcggtgatcctgccgtccctggtgaacgcgttcggcgtg
ttcttcatgcggcagtacctgctccaggcgctgcccgacgagatcatcgaggccgcgcgc
gtggacggcgccagcagctggcgtgtgatgtggcacgtggtgttcccggcggcgcggccc
gcgatggccgtgctcggcatgctgatgttcgtgcagtcctggaacgacttcctgtggccg
ttcctggtgctgacgcagaacggcagcccgaccgtgcaggtcgcactcgccggactgggc
cgcggctacaccccggaccagtccctgatcatggccggtgcgctgctgggcacgctgccg
ctgctgctggtgttcgcgatcttcggcaagcagatcgtgggcggcatcatgcagggcgcc
gtcaagggctga

DBGET integrated database retrieval system