KEGG   Streptomyces coelicolor: SCO2918Help
Entry
SCO2918           CDS       T00085                                 

Gene name
SCE19A.18
Definition
(RefSeq) nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sco  Streptomyces coelicolor
Pathway
sco00760  Nicotinate and nicotinamide metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SCO2918 (SCE19A.18)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SCO2918 (SCE19A.18)
    3.5.1.-  
     SCO2918 (SCE19A.18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 1098351
NCBI-ProteinID: NP_627144
Kitasato: SCO2918
UniProt: Q9S2G3
Position
3168248..3168835
Genome map
AA seq 195 aa AA seqDB search
MRRALIVVDVQNDFCEGGSLAVSGGADVAAAITELIGQAPAGYRHVVATRDHHVAPGGHF
ADNPDYVHSWPAHCVAGTEGVGFHPNFAPAVASGAIDAVFDKGAYAAAYSGFEGADENGT
GLAEWLRSREIDEVDVVGIATDHCVRATALDAAREGFRTQVLLDLTAGVAAETTERALEE
LREAGVELSGKPVVQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccttgatcgtcgttgacgtgcagaacgacttctgcgagggaggcagcctc
gcggtgtccggcggtgccgacgtggccgccgccatcaccgagctgatcgggcaggcgccc
gccggctaccgccacgtcgtggccacccgcgaccaccacgtggcgccgggcggccacttc
gccgacaacccggactacgtccactcctggccggcgcactgcgtggccggcaccgagggg
gtcggcttccacccgaacttcgcccccgccgtcgcctccggcgcgatagacgccgtcttc
gacaagggcgcgtacgcggccgcctacagcggcttcgagggcgccgacgagaacggcacc
ggcctcgccgagtggctgcgctcgcgcgagatcgacgaggtcgacgtcgtgggcatcgcc
accgaccactgcgtgcgggccaccgccctggacgccgcccgcgagggcttccgcacgcag
gtgctgctcgacctgaccgccggggtggccgcggagaccaccgagcgggcgctggaggag
ctgcgggaggcgggcgtggagctgtccggcaagccggtcgtgcagtag

DBGET integrated database retrieval system