KEGG   Streptomyces coelicolor: SCO2925Help
Entry
SCO2925           CDS       T00085                                 

Gene name
SCE19A.25c
Definition
(RefSeq) oxidoreductase subunit
  KO
K00104  glycolate oxidase [EC:1.1.3.15]
Organism
sco  Streptomyces coelicolor
Pathway
sco00630  Glyoxylate and dicarboxylate metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO2925 (SCE19A.25c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     SCO2925 (SCE19A.25c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 1098358
NCBI-ProteinID: NP_627151
Kitasato: SCO2925
UniProt: Q9S2F6
Position
complement(3175582..3177048)
Genome map
AA seq 488 aa AA seqDB search
MIMSRIEAPRDEDDAAAAVDSTPGSTPGSPLGDRSTLVGRLLAGLPAGSVLTDPDVTASY
ANDMASFCPAGAPAAVVLPRTVEDVQHVMRTATALRVPVVPQGARTGLSGAANATDGCVV
LSLTKMDRILEINPVDRVAVVEPGVVNATLSRAVNEHGLYYPPDPSSWEMCTIGGNIGTA
SGGLCCVKYGVTAEYVLGLDVVLADGRLMSTGRRTAKGVAGYDLTRLFVGSEGSLGIVVK
AVLGLRPKPPEQLVLAAEFASASAACDAICRIMEGGHVPSLLELMDRTTVKAVNDLAHMG
LPESTEALLLAAFDTTDPAADLAAVGALCEAAGATQVVPAEDAAESELLLQARRLALTAL
EAVKGTTMIDDVCVPRSRLGDMLEGIDRVAAKYGLTIGVCAHAGDGNTHPTVCFDVQDPD
ESRRARESFDEIMALGLELGGTITGEHGVGVLKKEWLAREIGPVGLEMQRAVKEVFDPLG
ILNPGKLF
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatgagccgtatcgaagcgcctcgcgacgaagacgacgcagccgcggcggtcgac
agcacccccggcagcacccccggcagtcccctcggcgaccggagcaccctcgtcggccgg
ctgctggccggtctgcccgccgggtccgtcctcaccgatcccgacgtcacggcctcctac
gccaacgacatggcgagcttctgcccggccggcgcccccgccgcggtcgtcctgccgcgc
accgtggaggacgtccagcacgtcatgcgcaccgccaccgcactgcgcgtcccggtggtc
ccgcagggcgcccgcaccggtctgtccggcgcggccaacgccaccgacggctgcgtggtc
ctctccctgacgaagatggaccgcatcctggagatcaacccggtcgaccgggtcgccgtc
gtcgaaccgggcgtcgtcaacgccacgctgtcccgcgcggtgaacgaacacggcctctac
tacccgccggacccctccagctgggagatgtgcacgatcggcggcaacatcggcaccgcc
tccggcggcctgtgctgcgtcaagtacggggtgaccgccgagtacgtcctcggcctcgac
gtcgtcctcgccgacggccgcctgatgtccaccgggcgccgcaccgccaagggcgtcgcc
gggtacgacctcacccggctcttcgtgggctccgagggctcactcggcatcgtggtgaag
gcggtcctcgggctgcgccccaagccgcccgagcagctggtgctggccgccgagttcgcc
tccgcgtccgccgcctgcgacgcgatctgccggatcatggaagggggccacgtcccctcc
ctcctcgaactgatggaccgtacgaccgtcaaggcggtcaacgacctcgcccacatgggc
ctcccggagagcaccgaggcgctcctgctcgccgccttcgacaccaccgacccggccgcc
gacctcgccgccgtcggcgccctgtgcgaggccgccggcgccacccaggtggtcccggcc
gaggacgccgccgagtccgaactcctcctccaggccaggcgcctggccctcaccgccctc
gaagccgtcaagggcaccacgatgatcgacgacgtgtgcgtgccccgctcccggctcggc
gacatgctggagggcatcgaccgggtcgccgccaagtacggcctcaccatcggggtctgc
gcccacgcgggcgacggcaacacccaccccaccgtctgcttcgacgtccaggaccccgac
gagtcccggcgggcccgcgagtccttcgacgagatcatggcgctcggcctggaactcggc
ggcaccatcaccggcgagcacggcgtgggcgtcctgaagaaggagtggctggcgcgggag
atcggcccggtgggcctggagatgcagcgggccgtcaaggaggtcttcgacccgctgggc
atcctcaacccgggcaagctcttctga

DBGET integrated database retrieval system