KEGG   Streptomyces coelicolor: SCO2927Help
Entry
SCO2927           CDS       T00085                                 

Gene name
SCE19A.27c
Definition
(RefSeq) 4-hydroxyphenylpyruvate dioxygenase
  KO
K00457  4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
sco  Streptomyces coelicolor
Pathway
sco00130  Ubiquinone and other terpenoid-quinone biosynthesis
sco00350  Tyrosine metabolism
sco00360  Phenylalanine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SCO2927 (SCE19A.27c)
   00360 Phenylalanine metabolism
    SCO2927 (SCE19A.27c)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SCO2927 (SCE19A.27c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO2927 (SCE19A.27c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     SCO2927 (SCE19A.27c)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO2927 (SCE19A.27c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_5 Glyoxalase_3
Motif
Other DBs
NCBI-GeneID: 1098360
NCBI-ProteinID: NP_627153
Kitasato: SCO2927
UniProt: Q9S2F4
Position
complement(3178620..3179765)
Genome map
AA seq 381 aa AA seqDB search
MTQTTHHTPDTARQADPFPVKGMDAVVFAVGNAKQAAHYYSTAFGMKLVAYSGPENGSRE
TASYVLESGSARFVFTSVIKPSTDWGTFLAQHVAEHGDGVVDLAIEVPDARAAHAYAVEH
GARSLAEPHEVKDEHGTVVLAAIATYGETRHTLVERTGYDGPYLPGYVAAKPMVAPPAQR
VFQAVDHCVGNVELGRMNEWVGFYNKVMGFTNMKEFVGDDIATEYSALMSKVVADGTLKV
KFPINEPAIAKKKSQIDEYLEFYGGAGVQHIALNTNDIVATVRAMRAAGVEFLDTPDSYY
DTLGEWAGETRVPVDVLRELKILVDRDEDGYLLQIFTKPVQDRPTVFFEMIERHGSMGFG
KGNFKALFEAIEREQEKRGNL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaccacacaccacactcccgacaccgcccggcaggccgatcccttcccggtc
aagggaatggacgcggtcgtcttcgccgtgggcaacgccaagcaggccgcgcactactac
tccaccgccttcggcatgaagctggtcgcgtactccggaccggagaacggcagccgggag
accgcgagctacgtcctggagagcggctccgcccgcttcgtgttcacctcggtgatcaag
ccctcgacggactggggcaccttcctggcccagcacgtggccgagcacggcgacggcgtc
gtcgacctcgccatcgaggtcccggacgcgcgcgccgcccacgcctacgccgtcgagcac
ggcgcccgctcgctcgccgagccgcacgaggtcaaggacgagcacggcaccgtcgtcctc
gccgccatcgccacctacggcgagacccggcacaccctcgtcgagcgcaccggctacgac
ggcccgtacctgcccggctacgtcgccgccaagccgatggtcgccccgcccgcgcagcgc
gtcttccaggccgtggaccactgcgtcggcaacgtcgaactcggccgcatgaacgagtgg
gtcggcttctacaacaaggtcatgggcttcacgaacatgaaggagttcgtgggcgacgac
atcgccaccgagtacagcgcgctgatgtcgaaggtcgtggccgacggaaccctcaaggtc
aagttcccgatcaacgagcccgccatcgccaagaagaagtcccagatcgacgagtacctg
gagttctacggcggcgccggcgtccagcacatcgcgctgaacaccaacgacatcgtggcg
accgtccgggcgatgagggcggccggcgtcgagttcctggacacccccgactcgtactac
gacacgctcggcgagtgggccggcgagacccgggtgcccgtcgacgtgctgcgcgagctg
aagatcctcgtcgaccgggacgaggacggctacctgctgcagatcttcaccaagccggtc
caggaccgcccgaccgtcttcttcgagatgatcgagcgccacggctccatgggcttcggc
aagggcaacttcaaggccctgttcgaggcgatcgagcgcgagcaggagaagcgcggcaac
ctctga

DBGET integrated database retrieval system