KEGG   Streptomyces coelicolor: SCO2988Help
Entry
SCO2988           CDS       T00085                                 

Gene name
galE2, SCE50.16
Definition
(RefSeq) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00052  Galactose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
Module
sco_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCO2988 (galE2)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO2988 (galE2)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     SCO2988 (galE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 NmrA NAD_binding_4 KR
Motif
Other DBs
NCBI-GeneID: 1098421
NCBI-ProteinID: NP_627211
Kitasato: SCO2988
UniProt: Q9L047
Position
3257700..3258680
Genome map
AA seq 326 aa AA seqDB search
MTWLITGGAGYIGAHVVRAMTEAGEKAVVYDDLSTGIAERVPDGVPLVVGSVLDGERVAR
ALADHSVTGVVHLAAKKQVGESVDLPLHYYRQNVEGLRVLLDAVTAAGVPSFVFSSSAAV
YGMPDVDLVTEETPCVPMSPYGETKLAGEWLVRATGRATGLATASLRYFNVAGAASPDLV
DTGVYNLVPMVFEKLTESAAPRIFGDDYATPDGTCVRDYIHVVDLAEAHVAAARALQSSP
GTALTLNIGRGEGVSVREMIDRINAVTGCDQPPTVTPRRPGDPARVVASADRAAVELGWK
AKYDVEDMITSAWAGWVRLHPEAARD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacctggctgatcaccggcggcgccggatacatcggggcgcacgtcgtacgggcgatg
accgaagcgggcgagaaggccgtggtctacgacgacctgtccacggggatcgccgagcgc
gtgcccgacggtgtgcccctggtggtgggctcggtcctggacggcgagcgggtcgcccgc
gccctggccgaccactccgtcaccggcgtggtgcacctggccgccaagaagcaggtcggc
gagtcggtggacctgccgctgcactactaccggcagaacgtggagggcctgcgggtcctg
ctggacgcggtcaccgcggccggggtcccgtccttcgtcttctcctcctccgccgcggtg
tacggcatgcccgacgtcgacctcgtgaccgaggagacgccctgcgtgccgatgtcgccg
tacggcgagaccaagctggcgggcgagtggctggtccgggccacgggcagggcgacgggc
ctcgccacggcctccctgcggtacttcaacgtggcgggcgcggcgagcccggacctggtc
gacaccggcgtctacaacctcgtcccgatggtcttcgagaagctcacggagtccgcggcc
ccccggatcttcggcgacgactacgcgacgccggacggcacctgcgtgcgcgactacatc
cacgtcgtggacctggccgaggcgcacgtggccgcggcccgcgcactccagtcctcgccc
ggcaccgccctcacgctgaacatcggccgcggcgagggcgtctccgtccgcgagatgatc
gaccggatcaacgccgtcaccggctgcgaccagccgccgacggtcaccccgcgccgcccc
ggcgacccggcgcgcgtcgtcgcctcggccgaccgggccgccgtcgaactgggctggaag
gccaagtacgacgtcgaggacatgatcacgtcggcgtgggcgggctgggtacggctccac
ccggaggcggcgcgggactga

DBGET integrated database retrieval system