KEGG   Streptomyces coelicolor: SCO3025Help
Entry
SCO3025           CDS       T00085                                 

Gene name
manA, SCE34.06c
Definition
(RefSeq) mannose-6-phosphate isomerase
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
sco  Streptomyces coelicolor
Pathway
sco00051  Fructose and mannose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCO3025 (manA)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO3025 (manA)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     SCO3025 (manA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMI_typeI Cupin_2
Motif
Other DBs
NCBI-GeneID: 1098458
NCBI-ProteinID: NP_627247
Kitasato: SCO3025
UniProt: Q9KZL9
Position
complement(3307981..3309132)
Genome map
AA seq 383 aa AA seqDB search
MDRLDNTVRPYAWGSTTAIPTLLGTEPTGEPQAEMWMGAHPGAPSRTGRGTLAEVVDADP
EKELGAASVARFGPRLPFLLKLLAAGAPLSLQVHPDLAQARAGYEDEERRGVPLDAPHRN
YKDANHKPELVCALTDFDGLCGFRAPAETADLLDGLGVASLKPYVDLLRAHPEDAALREV
LTAILTADPEEMSHTVTETAAACDRLGGAYRPYADIAHHYPGDPGVLAAMLLNHVRLQPG
EALYLGAGIPHAYLNGLGVEIMANSDNVLRCGLTPKHVDVPELLRIVRFEAGDPGILRPE
ASPDGEEVYDTPIDEFRLSRYVLPEGAGAHDLTLPTPQILLCTAGTVRAGEHELAPGRSV
FVPAHEKAEVSGTGTLFRATVRV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcctcgacaacaccgtccgcccctacgcctggggttccaccaccgcgatcccg
accctgctcgggaccgagccgaccggcgaaccgcaggcggagatgtggatgggcgcccac
cccggcgccccctcccgcaccggccggggcaccctcgccgaggtcgtcgacgccgacccc
gagaaggaactgggcgccgcgtccgtggccaggttcggcccccggctgcccttcctcctc
aagctcctcgccgccggcgccccgctctccctccaggtccaccccgacctcgcccaggcc
agggccggttacgaggacgaggagcgccgcggcgtccccctggacgccccgcaccgcaac
tacaaggacgccaaccacaagcccgaactggtctgcgccctcaccgacttcgacggcctg
tgcggcttccgcgccccggccgagacggccgacctgctcgacggcctgggcgtcgcctcc
ctcaagccgtacgtcgacctgctgcgcgcccaccccgaggacgccgccctgcgcgaggtc
ctcaccgcgatcctcaccgccgaccccgaggagatgtcccacaccgtcaccgagaccgcg
gccgcctgcgaccgcctcggcggcgcctaccggccgtacgccgacatcgcccaccactac
ccgggcgaccccggcgtcctcgccgcgatgctcctcaaccacgtccggctccagcccggc
gaggccctctacctcggcgccggcatcccccacgcctacctcaacggcctcggcgtcgag
atcatggccaactccgacaacgtcctgcgctgcgggctcacccccaagcacgtcgacgtc
cccgaactcctgcgcatcgtccgcttcgaggccggcgaccccggcatcctgcgcccggag
gcgtcccccgacggcgaagaggtctacgacaccccgatcgacgagttccgcctgagccgc
tacgtcctgcccgagggcgccggcgcccacgacctgaccctgcccaccccgcagatcctg
ctctgcacggcgggcaccgtacgagcgggcgaacacgaactggcccccggccgctcagtc
ttcgtaccggcgcacgaaaaggccgaagtgtccggaaccggcacgctcttccgggccacc
gtgcgcgtctga

DBGET integrated database retrieval system