KEGG   Streptomyces coelicolor: SCO3028Help
Entry
SCO3028           CDS       T00085                                 

Gene name
manB
Definition
(RefSeq) phosphomannomutase
  KO
K01840  phosphomannomutase [EC:5.4.2.8]
Organism
sco  Streptomyces coelicolor
Pathway
sco00051  Fructose and mannose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SCO3028 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO3028 (manB)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     SCO3028 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 1098461
NCBI-ProteinID: NP_627250
Kitasato: SCO3028
UniProt: Q9KZL6
Position
complement(3310820..3312184)
Genome map
AA seq 454 aa AA seqDB search
MAADLSQIVKAYDVRGVVPDQWDESLAELFGAAFVELTGAGAIVVGHDMRPSSPGLSDAF
ARGAAARGADVTGIGLCSTDQLYYASGALGLPGAMFTASHNPAQYNGIKLCRAGAAPVGQ
DTGLAEIRALVERWSEAGAPEPSARPGTVTRRDTLADYAAHLRSLVDLTGIRPLKVVVDA
GNGMGGHTVPTVFAGLPLDLVPMYFELDGTFPNHEANPLDPANLVDLQRRVREEGADLGL
AFDGDADRCFVVDQDGEPVSPSAVTALVAARELARNGGKGTVIHNLITSRSVPEVVRENG
GTPERTRVGHSFIKAEMARTGAIFGGEHSAHYYFRDFWNADTGMLAALHVLAALGEQDRP
LSALVAAYDRYAGSGEINSTVDDQQARLAAIRAVYEGRDDVTVDDLDGLTVQAPDWWFNV
RPSNTEPLLRLNAEARDEATMTKVRDEALAIIRA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtggctgctgatctgtcgcagatcgtgaaggcgtacgacgtgcgcggtgtcgtcccggac
cagtgggacgagtcgctggccgagctgttcggcgcggccttcgtcgagctgaccggcgcg
ggcgccatcgtggtcggccacgacatgcggccctcgtccccgggcctgtccgacgccttc
gcgcgcggcgcggcggcccgcggcgccgacgtgaccgggatcggcctgtgctccaccgac
cagctgtactacgcctccggcgcgctcggcctgccgggcgccatgttcacggcctcgcac
aaccccgcccagtacaacggcatcaagctgtgccgcgcgggcgccgccccggtcggccag
gacaccggcctcgccgagatccgcgccctggtggaacgctggagcgaggcgggcgccccg
gagccgtccgcccgccccggcaccgtcacccggcgcgacaccctcgccgactacgcggcc
cacctgcgctccctcgtcgacctcaccggcatcaggcccctcaaggtcgtcgtcgacgcg
ggcaacggcatgggcggccacaccgtccccacggtcttcgccggcctgcccctcgacctg
gtgccgatgtacttcgaactggacggcaccttccccaaccacgaggccaacccgctcgac
ccggccaacctcgtcgacctccagcggcgcgtccgcgaggagggcgccgacctcggtctc
gccttcgacggcgacgccgaccgctgcttcgtcgtcgaccaggacggcgagccggtctcc
ccgtccgccgtcaccgccctcgtggccgcccgcgagctggcccgcaacggcggcaagggc
accgtcatccacaacctgatcacctcccggtccgtccccgaggtcgtccgggagaacggc
ggcacaccggaacgcacgcgcgtgggccactccttcatcaaggccgagatggccaggacc
ggcgccatcttcggcggcgagcactccgcccactactacttccgggacttctggaacgcc
gacaccggcatgctggccgccctccacgtcctcgccgccctcggcgagcaggaccgcccg
ctgtccgccctggtcgccgcctacgaccgctatgccggctccggcgagatcaactccacc
gtcgacgaccagcaggcccgcctcgccgcgatccgggccgtctacgagggccgcgacgac
gtcaccgtggacgacctggacggcctcaccgtccaggcgcccgactggtggttcaacgtc
cgcccgtccaacaccgagccgctgctccgcctgaacgcggaggcccgcgacgaggcgacg
atgacgaaggtgcgcgacgaggccttggcgatcatccgggcgtga

DBGET integrated database retrieval system