KEGG   Streptomyces coelicolor: SCO3059Help
Entry
SCO3059           CDS       T00085                                 

Gene name
purE, SCBAC19G2.14c
Definition
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide mutase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO3059 (purE)
Enzymes [BR:sco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     SCO3059 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC HEAT
Motif
Other DBs
NCBI-GeneID: 1098492
NCBI-ProteinID: NP_627280
Kitasato: SCO3059
UniProt: Q93J44
Position
complement(3352225..3352767)
Genome map
AA seq 180 aa AA seqDB search
MSQASPVTPVVGIVMGSDSDWPVMEAAAKALDEFEVPYEVDVVSAHRMPHEMIAYGEQAA
GRGLKAIIAGAGGAAHLPGMLASVTPLPVIGVPVPLKYLDGMDSLLSIVQMPAGVPVATV
SVGGARNAGLLAARILAAHDEELLGRMREFQQDLNDQATEKGKRLRTKVEGSAAGFGFGK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggccagcccggtgaccccggtcgtgggcatcgtcatggggtcggactccgac
tggcccgtcatggaggccgccgccaaggccctcgacgagttcgaggtcccctacgaggtc
gacgtcgtctccgcgcaccgcatgccgcacgagatgatcgcgtacggcgagcaggccgcc
ggacgcggcctcaaggcgatcatcgcgggggccgggggcgccgcccacctgcccggcatg
ctcgcctcggtcacgccgctgccggtcatcggcgtcccggtgccgctgaagtacctggac
ggcatggacagcctgctgtccatcgtgcagatgccggccggcgtcccggtggccacggtc
tccgtcggcggcgcccgcaacgccggtctgctggccgcccgcatcctcgccgcccacgac
gaggaactgctcggccggatgcgcgagttccagcaggacctcaacgaccaggccaccgag
aagggcaagcggctgcgcaccaaggtcgagggctcagcggccggcttcggattcggaaag
tga

DBGET integrated database retrieval system