KEGG   Streptomyces coelicolor: SCO3060Help
Entry
SCO3060           CDS       T00085                                 

Gene name
purK, SCBAC19G2.15c, SCE25.01c
Definition
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide synthase
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO3060 (purK)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     SCO3060 (purK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp PurK_C CPSase_L_D2 Dala_Dala_lig_C
Motif
Other DBs
NCBI-GeneID: 1098493
NCBI-ProteinID: NP_733591
Kitasato: SCO3060
UniProt: Q8CJX8
Position
complement(3352764..3353999)
Genome map
AA seq 411 aa AA seqDB search
MRPATGGGRGRKRPVNRWAPRGRYARGVTFPVVGMVGGGQLARMTHEAGIPLGIRFKLLS
DTPQDSAAQVVNEVVVGDYRDLDTLREFARGCDVITFDHEHVPTEHLKALEADGIPVRPG
PEALVHAQDKGVMRAKLDAIGVPCPRHRIVRDPADVAAFAAEGAVEGGDGFPVVLKTVRG
GYDGKGVWVVDSVAEAAEPFRAGVPVLAEEKVDFVRELAANVVRSPHGQAVAYPVVESQQ
VKGVCDTVIAPAPDLDEALALRAEEMALGIAKELGVVGHLAVELFQTRDGRVLVNELAMR
PHNSGHWTMDGAITSQFANHVRAVLDLPLGDPRPRAKWTVMVNVLGGDYPDMYSAYLHCM
ARDPQLKIHMYGKDVKPGRKVGHVNTYGDDLDDVLERARHAAGYLRGTITE
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccgcaacgggcggtggccggggccggaaacggccggtaaacaggtgggctccg
cgcggccgatacgctaggggtgtgacgttccccgtagtcggcatggtcggcggtggccag
ctcgctcgtatgacacacgaggcgggcatcccgctcggcatcaggttcaagcttctcagt
gacactccccaggactctgcggcgcaggtcgtgaacgaagtcgtcgtcggcgactatcgc
gatctggacacgttgcgcgagttcgcgcgcggctgtgacgtgatcaccttcgatcacgag
cacgtgccgaccgagcacctcaaggccctggaggcggacggcatccccgtccgccccggt
cccgaggcgctcgtgcacgcccaggacaagggcgtgatgcgcgcgaagctcgacgcgatc
ggcgtgccctgcccgcggcaccggatcgtgcgcgatccggccgacgtggccgccttcgcg
gcggagggcgccgtggagggcggggacggcttccccgtcgtcctcaagacggtccgcggc
gggtacgacggcaagggcgtgtgggtcgtggactcggtggcggaggcggccgagcccttc
cgcgccggggtgcccgtgctggcggaggagaaggtcgacttcgtccgcgagctggccgcc
aacgtggtccgctccccgcacggccaggcggtggcctaccccgtcgtcgagtcccagcag
gtcaagggcgtctgcgacacggtgatcgcccccgcacccgatctggacgaggcgctggcc
ctgcgcgccgaggagatggcgctcggtatcgccaaggagctgggcgtcgtcggacacctc
gccgtcgagctgttccagacccgcgacggccgcgtcctcgtcaacgaactggcgatgcgc
ccgcacaactccggccactggaccatggacggcgcgatcacctcgcagttcgccaaccac
gtccgcgcggtcctcgacctccccctcggcgacccgcgcccgcgggccaagtggacggtg
atggtcaacgtcctgggcggcgactacccggacatgtactccgcgtacctgcactgcatg
gcccgcgacccgcagctcaagatccacatgtacggcaaggacgtgaagcccggccgcaag
gtcggccacgtcaacacctacggcgacgacctggacgacgtgctggagcgcgcccgtcac
gctgccggttacctgagagggacgatcaccgaatga

DBGET integrated database retrieval system