KEGG   Streptomyces coelicolor: SCO3072Help
Entry
SCO3072           CDS       T00085                                 

Gene name
SCE25.13c
Definition
(RefSeq) allantoate amidohydrolase
  KO
K06016  beta-ureidopropionase / N-carbamoyl-L-amino-acid hydrolase [EC:3.5.1.6 3.5.1.87]
Organism
sco  Streptomyces coelicolor
Pathway
sco00240  Pyrimidine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO3072 (SCE25.13c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     SCO3072 (SCE25.13c)
    3.5.1.87  N-carbamoyl-L-amino-acid hydrolase
     SCO3072 (SCE25.13c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 1098505
NCBI-ProteinID: NP_627292
Kitasato: SCO3072
UniProt: Q9KZ76
Position
complement(3364615..3365832)
Genome map
AA seq 405 aa AA seqDB search
MSFHSMWAELLPVGRSSASGGYRRAAWTGADADCRTWFQEQAEARGLTYETDRNGNQWAW
LGDPAAGNAVVTGSHLDSVPDGGAFDGPLGVVSAFAALDELRGRGARFTRPLGIVNFGDE
EGARFGLACVGSRLTSGALTVEQAHRLTDGDGITLPQAMEAAGYDPGTLGPDPERLARIG
AFVELHVEQGRALDLSGDRIGIASAIWPHGRWRFDFRGEANHAGTTRLADRHDPMLPYAE
TVLAARREAQLAGAVATFGKIGVEPNGVNAVPSLVRGWLDSRAADQASLDTVVTGIEKAA
REYAAARGVDLDVVRESFTPVVEFDHALRDELGRILGTGTDLKVPVLGTGAGHDAGILSD
RIPTAMLFVRNPTGVSHSPAEYAAEDDCVAGVNALADVLEGLACT
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttccacagcatgtgggcggagctgctgccggtcggccgcagctccgcctccggc
ggctaccgccgcgccgcctggaccggcgccgacgccgactgccggacctggttccaggag
caggccgaggcccgcggcctgacctacgagaccgaccgcaacggcaaccagtgggcctgg
ctcggcgacccggcggccgggaacgccgtcgtcaccgggtcccacctggactccgtgccc
gacggcggcgccttcgacggccccctcggcgtggtctccgccttcgccgccctcgacgaa
ctgcgcgggaggggagcgcggttcaccaggccgctcggcatcgtcaacttcggcgacgag
gagggcgcccgcttcggcctcgcctgcgtcggctcccggctcacctccggcgcgctcacc
gtcgagcaggcccaccgcctcaccgacggcgacggcatcacgcttccgcaggccatggag
gccgccgggtacgacccgggcaccctcggccccgaccccgaacggctcgcccgcatcggc
gccttcgtcgaactccacgtcgagcagggccgcgccctcgacctgtccggcgaccgcatc
ggcatcgcctccgccatctggccgcacggacgctggcggttcgacttccggggcgaggcc
aaccacgccggcaccacccgcctcgccgaccggcacgacccgatgctgccgtacgcggag
accgtcctcgccgcccgccgcgaggcccaactcgccggtgccgtcgccaccttcggcaag
atcggcgtcgaacccaacggtgtcaacgccgtcccctccctggtgcgcggctggctcgac
tcccgagccgccgaccaggcgagcctggacaccgtggtcaccggcatcgagaaggccgcc
cgcgagtacgccgcagcccggggcgtggacctcgacgtggtccgcgagtccttcacgccc
gtcgtcgagttcgaccacgccctgcgcgacgaactcggacgcatcctgggcacggggacg
gacctgaaggtgcccgtcctcggtaccggcgccggacacgacgccgggatcctctccgac
cgcatcccgaccgccatgctgttcgtacgcaaccccaccggcgtctcgcactccccggcc
gagtacgccgccgaggacgactgcgtggccggggtgaacgcactcgccgacgtactggaa
gggctggcctgcacgtga

DBGET integrated database retrieval system