KEGG   Streptomyces coelicolor: SCO3073Help
Entry
SCO3073           CDS       T00085                                 

Gene name
hutU, SCE25.14c
Definition
(RefSeq) urocanate hydratase
  KO
K01712  urocanate hydratase [EC:4.2.1.49]
Organism
sco  Streptomyces coelicolor
Pathway
sco00340  Histidine metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SCO3073 (hutU)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.49  urocanate hydratase
     SCO3073 (hutU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urocanase_C Urocanase Urocanase_N
Motif
Other DBs
NCBI-GeneID: 1098506
NCBI-ProteinID: NP_627293
Kitasato: SCO3073
UniProt: Q9KZ75
Position
complement(3365829..3367547)
Genome map
AA seq 572 aa AA seqDB search
MSGPRPVRAPRGTEPSALGWQQEAALRMLQNNLDPEVAEHPDKLVVYGGTGKAARDWRSF
DAMVRTLRTLKQDETMLVQSGRPVGVMQTHEWAPRVLIANSNLVGDWANWEEFRRLEALG
LTMYGQMTAGSWIYIGTQGILQGTYETFAAVAAKKFGGTLAGTITLTAGLGGMGGAQPLA
VTMNDGVVICVDCDPRAIDRRIEHHYLDVKADSLDHALQLATEARDRRKPLSIGVLGNAA
ELVPQLLAMGAPIDIVTDQTSAHDPLAYLPTGIAFEDMADAAAKDPAGFTTRARESMARH
VEAMVGFQDAGAEVFDYGNSIRGEAQLAGYDRAFAFPGFVPAYIRPLFCEGKGPFRWAAL
SGDPADIAKTDKAILDLFPENESLARWIKMAGERVHFQGLPARICWLGYGERDKAGERFN
DMVASGELAAPIVIGRDHLDCGSVASPYRETEAMLDGSDAIADWPLLNAMVNVASGASWV
SLHHGGGVGMGRSIHAGQVTVADGTPLAGEKIRRVLTNDPGMGVIRHVDAGYDIAESVAA
ERDVRVPMREGDEAHEGDAAHGSGAAREGDGV
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtccggacctcgtcccgtccgagcgccacgcggtaccgagccgagcgccctgggctgg
cagcaggaggccgccctgcggatgctgcagaacaacctcgacccggaggtcgccgagcac
cccgacaagctcgtcgtctacggcggcacgggcaaggcggcccgcgactggcgctccttc
gacgcgatggtgcggaccctgcgcaccctcaagcaggacgagacgatgctcgtccagtcc
ggccgcccggtcggcgtcatgcagacccacgagtgggccccgcgcgtcctcatcgccaac
tccaacctcgtcggcgactgggccaactgggaggagttccgccgcctggaggccctcggc
ctgaccatgtacgggcagatgacggccggctcctggatctacatcggcacccagggcatc
ctccagggcacctacgagaccttcgccgccgtcgccgccaagaagttcggcggcaccctg
gccgggaccatcaccctcaccgccggcctcggcggcatgggcggcgcccagcccctcgcg
gtcaccatgaacgacggcgtcgtcatctgcgtcgactgcgacccgcgcgccatcgaccgc
cgcatcgagcaccactacctcgacgtgaaggccgactccctcgaccacgccctccagctg
gccaccgaggcccgcgaccggcgcaagccgctgtccatcggcgtcctcggcaacgccgcc
gagctggtcccgcagctcctcgccatgggcgccccgatcgacatcgtcaccgaccagacc
tcggcccacgacccgctggcctacctgcccaccggtatcgccttcgaggacatggccgac
gcggcggccaaggacccggccggcttcaccacccgggcccgcgagtccatggcccggcac
gtcgaggccatggtcggcttccaggacgccggtgccgaggtcttcgactacggcaactcg
atccgcggcgaggcccagctcgccggatacgaccgggccttcgccttccccggcttcgtc
cctgcctacatccgcccgctgttctgcgagggcaagggccccttccggtgggccgccctg
tccggcgaccccgccgacatcgccaagaccgacaaggcgatcctcgacctcttccccgag
aacgagtccctggcccgctggatcaagatggcgggggagcgggtccacttccagggcctg
cccgcccgcatctgctggctcggctacggcgagcgggacaaggcaggcgagcggttcaac
gacatggtcgcgagcggcgagctggccgctccgatcgtcatcggccgcgaccacctcgac
tgcggctccgtcgcctccccgtaccgcgagaccgaggccatgctcgacggctccgacgcc
atcgccgactggccgctgctcaacgccatggtcaacgtggcctccggtgcctcctgggtc
tccctccaccacggcggcggcgtcggcatgggccgctccatccacgccgggcaggtcacc
gtcgccgacggcaccccgctcgccggggagaagatccgccgggtgctcaccaacgacccc
ggcatgggcgtcatccggcacgtcgacgccgggtacgacatcgccgagtcggtggcggcc
gagcgcgacgtgcgggtgccgatgcgcgagggcgacgaggcgcacgagggcgacgcggcg
cacgggagcggtgcggcgcgcgagggtgacggcgtgtga

DBGET integrated database retrieval system