KEGG   Streptomyces coelicolor: SCO3077Help
Entry
SCO3077           CDS       T00085                                 

Gene name
SCE25.18c
Definition
(RefSeq) cystathionine beta-synthase
  KO
K01697  cystathionine beta-synthase [EC:4.2.1.22]
Organism
sco  Streptomyces coelicolor
Pathway
sco00260  Glycine, serine and threonine metabolism
sco00270  Cysteine and methionine metabolism
sco01100  Metabolic pathways
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00035  Methionine degradation
sco_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO3077 (SCE25.18c)
   00270 Cysteine and methionine metabolism
    SCO3077 (SCE25.18c)
Enzymes [BR:sco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     SCO3077 (SCE25.18c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP CBS
Motif
Other DBs
NCBI-GeneID: 1098510
NCBI-ProteinID: NP_627297
Kitasato: SCO3077
UniProt: Q9KZ71
Position
complement(3370359..3371744)
Genome map
AA seq 461 aa AA seqDB search
MQFHDSMISLVGNTPLVRLNSVSKGIRATVLAKVEYFNPGGSVKDRIALRMIEAAEKSGE
LQPGGTIVEPTSGNTGVGLAIVAQQKGYKCIFVCPDKVSTDKINVLRAYGAEVVVCPTAV
DPEHPDSYYNVSDRLVRETPGAWKPDQYSNPNNPLSHYHSTGPELWEQTEGKITHFVAGV
GTGGTISGTGRYLKDASDGAVTVIGADPEGSVYSGGSGRPYLVEGVGEDFWPTAYDREVA
DEIVAVSDKDSFQMTRRLAKEEGLLVGGSCGMAVVAALEVAARLGEDDVVVVLLPDSGRG
YLSKIFNDEWMADYGFLEDTGPSARVAEVLNHKEGGHIPSLVHMHPDETVGQAIEVLREY
GVSQMPIVKPGAGHPDVMAAEVVGSVVERELLDALFAKRASLEDPLEKHMSAPLPQVGSG
EPVADLMSVLGGADAAIVLVEGKPTGVVSRQDLLSFLAKVK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgcaattccacgactcgatgatcagcctcgtcggcaacaccccgctggtgcggctcaac
agcgtgagcaaggggatcagggcgaccgtcctggccaaggtggagtacttcaacccgggc
ggctcggtgaaggaccgcatcgccctgcgcatgatcgaggccgcggagaagagcggtgag
ctgcagccgggcggcacgatcgtcgagccgaccagcggcaacaccggcgtcggcctcgcc
atcgtggcccagcagaagggctacaagtgcatcttcgtctgccccgacaaggtgtccacc
gacaagatcaacgtgctgcgcgcgtacggcgccgaggtcgtcgtctgcccgaccgccgtc
gacccggagcaccccgactcctactacaacgtctccgaccggctggtccgcgagacgccg
ggcgcctggaagccggaccagtactccaacccgaacaacccgctctcccactaccactcc
acgggccccgagctgtgggagcagaccgaggggaagatcacccacttcgtggccggggtc
ggcaccggcggcaccatctccggcaccggccggtacctgaaggacgccagtgacggcgcg
gtcacggtgatcggcgccgaccccgagggctccgtctactccggcggctccgggcgcccc
tacctggtcgagggcgtcggcgaggacttctggccgacggcgtacgaccgcgaggtcgcc
gacgagatcgtcgccgtctccgacaaggactccttccagatgacccgccgcctcgccaag
gaggagggcctgctggtgggcggctcctgcggcatggcggtcgtcgcggcgctggaagtg
gcggcgcggctcggcgaggacgacgtggtggtcgtcctgctgccggacagcggacgcggc
tatctcagcaagatcttcaacgacgagtggatggccgactacggcttcctggaggacacg
ggccccagcgcccgcgtcgcggaggtcctgaaccacaaggagggcggccacatcccctcc
ctcgtccacatgcacccggacgaaaccgtcggccaggccatcgaggtgctgcgcgagtac
ggcgtctcgcagatgccgatcgtcaagcccggcgccggtcacccggacgtgatggccgcc
gaggtcgtcggctcggtggtggagcgcgagctgctggacgcgctgttcgccaagcgcgcc
tcgctggaggacccgctggagaagcacatgtccgccccgctgccccaggtcggctccgga
gagccggtcgcggacctgatgtcggtgctcggcggcgccgacgcggcgatcgtcctcgtc
gagggcaagccgaccggtgtggtgagccggcaggacctgctgtccttcctcgccaaggtc
aagtag

DBGET integrated database retrieval system