KEGG   Streptomyces coelicolor: SCO3079Help
Entry
SCO3079           CDS       T00085                                 

Gene name
SCE25.20
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00071  Fatty acid degradation
sco00072  Synthesis and degradation of ketone bodies
sco00280  Valine, leucine and isoleucine degradation
sco00310  Lysine degradation
sco00362  Benzoate degradation
sco00380  Tryptophan metabolism
sco00620  Pyruvate metabolism
sco00630  Glyoxylate and dicarboxylate metabolism
sco00640  Propanoate metabolism
sco00650  Butanoate metabolism
sco00900  Terpenoid backbone biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01212  Fatty acid metabolism
sco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO3079 (SCE25.20)
   00630 Glyoxylate and dicarboxylate metabolism
    SCO3079 (SCE25.20)
   00640 Propanoate metabolism
    SCO3079 (SCE25.20)
   00650 Butanoate metabolism
    SCO3079 (SCE25.20)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCO3079 (SCE25.20)
   00072 Synthesis and degradation of ketone bodies
    SCO3079 (SCE25.20)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO3079 (SCE25.20)
   00310 Lysine degradation
    SCO3079 (SCE25.20)
   00380 Tryptophan metabolism
    SCO3079 (SCE25.20)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO3079 (SCE25.20)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO3079 (SCE25.20)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCO3079 (SCE25.20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO3079 (SCE25.20)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SCO3079 (SCE25.20)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO3079 (SCE25.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 1098512
NCBI-ProteinID: NP_627299
Kitasato: SCO3079
UniProt: Q9KZ69
Position
3373160..3374380
Genome map
AA seq 406 aa AA seqDB search
MPEAVIVSAARSPIGRAFKGSLKDLRADDLAATIIQAALAKVPELDPRDIDDLMLGCGLP
GGEQGNNLGRIVAVEMGMDHLPGCTVTRYCSSSLQTSRMALHAIKAGEGDVFISAGVEMV
SRFAKGNSDSLPDTRNPLFAEAEARTAEVAQQEGTTWHDPREDGLVPDPYIAMGQTAENL
ARAKGITRQDMDEFGVRSQNLAEEAIKNGFWEREITPVTLPDGTVVSKDDGPRAGVTLEG
VQGLKPVFRPDGLVTAGNCCPLNDGAAALVIMSDTKARELGLTPLARIVSTGVSGLSPEI
MGLGPVEASKQALSRAGLGVGDIDLVEINEAFAAQVIPSYRDLGIPLEKLNVNGGAIAVG
HPFGMTGARITGTLINSLRTHDKQFGLETMCVGGGQGMAMVIERLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgtgatcgtctctgccgcccgttcccccatcggccgcgccttcaagggc
tccctgaaggacctgcgcgccgacgacctggccgccacgatcatccaggcggccctcgcg
aaggtgcccgagctggacccgcgggacatcgacgacctgatgctcggctgcggcctgccc
ggcggcgagcagggcaacaacctcggccggatcgtcgccgtcgagatgggcatggaccac
ctgccgggctgcaccgtcacccggtactgctcctcgtccctgcagacctcccgcatggcc
ctgcacgccatcaaggccggtgagggcgacgtcttcatctcggccggcgtcgagatggtc
tcccggttcgccaagggcaactccgacagcctcccggacacccgcaacccgctcttcgcc
gaggccgaggcccgcaccgcggaggtcgcccagcaggagggcaccacctggcacgacccg
cgcgaggacggcctcgtccccgacccgtacatcgcgatgggccagaccgccgagaacctc
gcccgcgccaagggcatcacccggcaggacatggacgagttcggcgtccggtcccagaac
ctcgccgaggaagccatcaagaacggcttctgggagcgcgagatcaccccggtgaccctg
cccgacggcacggtcgtcagcaaggacgacggcccccgggccggcgtcaccctggagggc
gtccagggcctcaagccggtcttccgccccgacggcctggtcaccgccggcaactgctgc
ccgctcaacgacggcgccgccgccctcgtgatcatgagcgacaccaaggcccgcgagctg
ggcctgaccccgctggcccgcatcgtctccaccggcgtctccggcctctcccccgagatc
atgggcctgggcccggtcgaggccagcaagcaggccctgtcccgggccgggctgggcgtc
ggcgacatcgacctggtcgagatcaacgaggcgttcgccgcgcaggtcatcccctcctac
cgcgacctcggcatcccgctggagaagctgaacgtcaacggcggcgccatcgccgtcggc
caccccttcggcatgaccggcgcccgcatcacgggcacgctgatcaactccctgcggacg
cacgacaagcagttcggcctggagaccatgtgcgtcggcggcggccagggcatggccatg
gtgatcgagcgcctgagctga

DBGET integrated database retrieval system