KEGG   Streptomyces coelicolor: SCO3123Help
Entry
SCO3123           CDS       T00085                                 

Gene name
prsA2, SCE66.02
Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
sco  Streptomyces coelicolor
Pathway
sco00030  Pentose phosphate pathway
sco00230  Purine metabolism
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01200  Carbon metabolism
sco01230  Biosynthesis of amino acids
Module
sco_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SCO3123 (prsA2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SCO3123 (prsA2)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     SCO3123 (prsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase PRAS PRTase_2
Motif
Other DBs
NCBI-GeneID: 1098557
NCBI-ProteinID: NP_627340
Kitasato: SCO3123
UniProt: Q9K3U0
Position
3423989..3424963
Genome map
AA seq 324 aa AA seqDB search
MTGIKTTGEKKMMFFSGRAHPELAEEVAQQLGVGVVPTKAFDFANGEIYVRYQESARGAD
CFLIQSHTAPINKWVMEQLIMIDALKRASARSITVIVPFYGYARQDKKHRGREPISARLI
ADLMKTAGADRILAVDLHTDQIQGFFDGPVDHLFALPLLADYVGAKVDRSKLTVVSPDAG
RVRVADRWCDRLGAPLAIVHKRRDKDVANQVTVHEVVGDVKGRICVLVDDMIDTGGTICA
AADALFAHGAEDVIVTATHGVLSGPAADRLKNSKVSEFVFTNTLPSASELELDKITVLSI
APTIARAVREVFEDGSVTSLFDEQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgggatcaagacgaccggcgagaagaagatgatgttcttctccggccgcgcacac
cccgagcttgccgaggaggtcgcccagcagctgggggtcggggtcgtcccgacgaaggcc
ttcgacttcgccaacggtgagatctatgtgcggtatcaggagtcggcgcgtggtgcggac
tgtttcctgatccagagccacacggctccgatcaacaagtgggtcatggagcagttgatc
atgatcgacgcgctgaagcgcgcgtcggcccgctccatcaccgtcatcgtgccgttctac
ggttacgcgcggcaggacaagaagcaccgtgggcgtgaaccgatctcggcgcgtctgatc
gcggatctgatgaagaccgcgggtgcggaccggatcctggcggtggatctgcacacggat
cagatccagggcttcttcgacggtccggtggaccacctgttcgcgttgccgctgctggcg
gactacgtgggtgcgaaggtggaccgttcgaagctgacggtggtgtcgccggacgcgggc
cgggtgcgggtggcggaccggtggtgcgaccgtctgggcgcgccgctggcgatcgtgcac
aagcggcgcgacaaggacgtggcgaaccaggtcacggtgcacgaggtcgtgggtgacgtg
aaggggcgcatctgcgtcctggtggacgacatgatcgacacgggtggcacgatctgcgcg
gcggcggacgcgctgttcgcgcacggtgcggaggacgtcatcgtgacggcgacgcacggt
gtgctgtcgggtccggcggcggaccgtctgaagaactcgaaggtgagcgagttcgtgttc
acgaacacgctgccgtcggcgagtgagctggagctggacaagatcacggtgctgtcgatc
gcgccgacgatcgcgcgtgcggtgcgtgaggtgttcgaggacggttcggtgacgagcctg
ttcgacgagcagtga

DBGET integrated database retrieval system