KEGG   Streptomyces coelicolor: SCO3136Help
Entry
SCO3136           CDS       T00085                                 

Gene name
galK, SCE66.15c
Definition
(RefSeq) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
sco  Streptomyces coelicolor
Pathway
sco00052  Galactose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
Module
sco_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
sco_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SCO3136 (galK)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO3136 (galK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sco04147]
    SCO3136 (galK)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     SCO3136 (galK)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO3136 (galK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 1098570
NCBI-ProteinID: NP_627353
Kitasato: SCO3136
UniProt: Q9K3S8
Position
complement(3436463..3437626)
Genome map
AA seq 387 aa AA seqDB search
MGEAVAGTVGERFRELYGAEPEGVWAAPGRVNLIGEHTDYNDGFVMPFALPHQAVAAVSR
RDDGILRLHSADIDADPVELRVADLAPGSDKSWTAYPSGVLWALREAGHELTGADVHLAS
TVPSGAGLSSSAALEVVLALAMNDLYALGLRGWQLARLCQRAENVYVGAPVGIMDQTASA
CCEAGHALFLDTRDLSQRQIPFDLAAEGMRLLVVDTRVKHSHSEGEYGKRRAGCEKGAAL
LGVDALRDVPYADLDAALERLGDEEEVRRLVRHVVTEDERVERVVALLESGDTRAIGAVL
VEGHASLRDDFRISCPELDLVVDTALASGALGARMTGGGFGGSAIVLVEAAGVDAVTKAV
EDAFAAAGLKAPRVFEAVPSAGARRLV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggctgtcgcgggaaccgtcggcgagcggttccgggagctgtacggggcggag
ccggagggggtgtgggcggcgccgggccgggtgaacctcatcggggagcacaccgactac
aacgacggcttcgtcatgcccttcgccctgccgcaccaggccgtcgcggccgtctcccgg
cgcgacgacggcatcctgcgcctgcactcggccgacatcgacgccgacccggtcgagctg
cgcgtcgccgacctggcccccggctcggacaagtcctggacggcgtacccctcgggcgtc
ctgtgggcgctgcgcgaggccggacacgagctgaccggcgccgacgtccacctggcctcg
accgtcccgtccggggcggggctctcctcctccgcggccctggaggtcgtcctcgccctg
gcgatgaacgacctgtacgccctcggcctgcgcggctggcagctggcccggctgtgccag
cgcgcggagaacgtctacgtcggcgcccccgtcggcatcatggaccagacggcgtccgcc
tgctgcgaggcggggcacgccctcttcctcgacacccgcgacctctcccagcggcagatc
cccttcgacctcgccgccgaggggatgcgcctgctggtcgtcgacacccgggtcaagcac
tcccacagcgagggcgagtacggcaagcgccgcgcgggctgcgagaagggcgccgcgctg
ctgggcgtcgacgcgctgcgcgacgtgccgtacgccgacctggacgcggcgctggagcgg
ctgggcgacgaggaggaggtgcgccgcctggtccggcacgtggtgaccgaggacgagcgc
gtcgaacgggtggtcgcgctgctggagtccggcgacacccgggccatcggcgccgtcctg
gtcgagggccacgcctcgctgcgcgacgacttccgcatctcctgccccgagctggacctg
gtcgtcgacacggccctggcctccggcgccctcggcgcccggatgaccggcggcggcttc
ggcggctcggcgatcgtcctggtggaggccgccggcgtggacgccgtcaccaaggcggtc
gaggacgccttcgccgcggcgggcctcaaggctccgcgggtgttcgaggcggtgccctcg
gcgggggcgcggcgcctggtctga

DBGET integrated database retrieval system