KEGG   Streptomyces coelicolor: SCO3137Help
Entry
SCO3137           CDS       T00085                                 

Gene name
galE1, SCE66.16c
Definition
(RefSeq) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
sco  Streptomyces coelicolor
Pathway
sco00052  Galactose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
Module
sco_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SCO3137 (galE1)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO3137 (galE1)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     SCO3137 (galE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 NmrA KR NAD_binding_4 adh_short UDPG_MGDP_dh_N TrkA_N NAD_binding_8 Methyltransf_11 Pyr_redox_2 ApbA 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 1098571
NCBI-ProteinID: NP_627354
Kitasato: SCO3137
UniProt: Q9K3S7
Position
complement(3437662..3438627)
Genome map
AA seq 321 aa AA seqDB search
MSGKYLVTGGAGYVGSVVAQHLVEAGHEVVVLDNLSTGFREGVPAGASFVEGDIRDAAKW
LDGSFDGVLHFAAFSQVGESVVKPEKYWDNNVGGTMALLEAMRGAGVRRLVFSSTAATYG
EPEQVPIVESAPTRPTNPYGASKLAVDHMITGEAAAHGLGAVSLRYFNVAGAYGEYGERH
DPESHLIPLVLQVAQGRREAISVYGDDYPTPDGTCVRDYIHVADLAEAHLLAVAAAAPGE
HLICNLGNGNGFSVREVVETVRRVTGHPIPEIMAPRRGGDPAVLVASAGTAREKLGWNPS
RADLAGIVSDAWEFAQRRAGQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaagtacctggtgacaggtggtgccggatacgtcggcagcgtcgtcgcccag
cacttggtggaggcggggcacgaggtcgtcgtgctcgacaatctgtcgaccggcttccgt
gagggtgtgccggcgggtgcctcgttcgtcgagggcgacatccgggacgccgccaagtgg
ctggacggctcgttcgacggcgtgctgcacttcgccgccttctcccaggtcggcgagtcg
gtcgtgaagcccgagaagtactgggacaacaacgtcggtggcaccatggcgctgctggag
gccatgcggggcgcgggtgtgcggcggctcgtcttctcctccacggccgccacgtacggc
gagcccgagcaggttcccatcgtcgagtccgcgccgacgaggcccaccaatccgtacggc
gcctcgaagctcgccgtcgaccacatgatcaccggcgaggcggcggcccacgggctgggc
gcggtctcgctgcgctacttcaacgtcgcgggcgcgtacggggagtacggcgagcgccac
gaccccgagtcgcatctgattccgctggtccttcaagtggcgcagggcaggcgggaggcc
atctccgtctacggcgacgactacccgacgccggacggcacctgtgtgcgcgactacatc
cacgtcgccgacctggccgaggcccacctgctggccgtggcggccgccgccccgggcgag
cacctcatctgcaacctgggcaacggcaacggcttctccgtccgcgaggtcgtcgagacc
gtgcggcgggtgacgggccatccgatccccgagatcatggccccgcgccggggcggcgac
ccggcggtcctggtcgcgtcggccggcaccgcccgcgagaagctgggctggaacccgtcc
cgcgcggacctcgcgggcatcgtgtcggacgcgtgggagttcgcgcagcggcgcgcgggc
cagtag

DBGET integrated database retrieval system