KEGG   Streptomyces coelicolor: SCO3148Help
Entry
SCO3148           CDS       T00085                                 

Gene name
SCE66.27c
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sco  Streptomyces coelicolor
Pathway
sco00900  Terpenoid backbone biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01130  Biosynthesis of antibiotics
Module
sco_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sco00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCO3148 (SCE66.27c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SCO3148 (SCE66.27c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 1098582
NCBI-ProteinID: NP_627365
Kitasato: SCO3148
UniProt: Q9K3R6
Position
complement(3449047..3449946)
Genome map
AA seq 299 aa AA seqDB search
MSVTVRVPAKVNVQLAVGAARPDGFHDLANVFLAVSLYDEVTATPAADGLRVTCEGPDAG
QVPLDRTNLAARAAEALAARYGRAPDVHLHIAKDIPVAGGMAGGSADGAGALLACDALWG
TGASREELLEICAGLGSDVPFSLVGGAALGTGRGERLAELEVGGDFHWVFALAARGLSTP
AVFREFDRLGEGLDLPEPVADQAVLDALAKGDAAALAVAVTNDLQPAALSLFPELSDTLA
AGRAAGALAALVSGSGPTTAFLATDARSASDIAGVLRASGTCRDVRTAVGAAAGATVLD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgacggtccgcgttcccgccaaggtcaacgtccagctcgcggtcggcgccgcc
cgccccgacggcttccacgacctggccaacgtcttcctcgccgtctccctgtacgacgag
gtcaccgcgaccccggccgccgacggactccgcgtcacctgcgaggggcccgacgccggc
caggtccccctggaccgcaccaacctcgcggcgcgcgcggccgaggcactggccgcgcgg
tacggccgcgcacccgacgtccacctccacatcgccaaggacatccccgtcgccggcggc
atggcgggcggcagcgccgacggcgcgggagcgctgctcgcctgcgacgccctgtggggc
accggcgcctctcgcgaggagctgctggagatctgcgccgggctgggcagcgacgtgccg
ttcagcctggtcggcggggccgcgctgggcaccgggcggggggagcggctggcggagctg
gaggtggggggcgacttccactgggtgttcgcgctggccgcgcggggactgtcgacgccg
gccgtcttccgcgagttcgaccggctcggtgagggcctggaccttcccgagccggtcgcc
gaccaggcggtgctcgacgccctggccaagggcgacgccgccgcgctcgccgtcgccgtc
accaacgacctccagcccgccgcgctctccctcttccccgagctgtccgacaccctcgcc
gcgggacgggcggccggagcgctggcggccctggtctcgggctccgggcccacgacggcc
ttcctcgccaccgacgccaggtccgcctccgacatcgcgggggtgctgcgggcctcgggg
acctgccgggacgtgcgtacggcggtgggggcggcggcgggggccaccgtcctggactga

DBGET integrated database retrieval system