KEGG   Streptomyces coelicolor: SCO3182Help
Entry
SCO3182           CDS       T00085                                 

Gene name
gtaB
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sco  Streptomyces coelicolor
Pathway
sco00040  Pentose and glucuronate interconversions
sco00052  Galactose metabolism
sco00500  Starch and sucrose metabolism
sco00520  Amino sugar and nucleotide sugar metabolism
sco01100  Metabolic pathways
sco01130  Biosynthesis of antibiotics
Module
sco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCO3182 (gtaB)
   00052 Galactose metabolism
    SCO3182 (gtaB)
   00500 Starch and sucrose metabolism
    SCO3182 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    SCO3182 (gtaB)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCO3182 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 1098616
NCBI-ProteinID: NP_627397
Kitasato: SCO3182
UniProt: Q9RKA6
Position
complement(3486550..3487461)
Genome map
AA seq 303 aa AA seqDB search
MTQSHPRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVTAGLGDVLMV
TGRNKRPLEDHFDRNYELESALQKKGDASRLAKVQESSDLAMMHYVRQGDPKGLGHAVLC
AAPHVGHEPFAVLLGDDLIDPRDPLLQRMIDVQEQYGGSVIALMEVAPEQIHLYGCAAVE
STADSDVVKVGGLVEKPDPADAPSNYAIIGRYVLDPHVFDILRKTEPGRGGEIQLTDALQ
QLAEDESVGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPDFRTWLRSYVAEEM
QGR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtcccaccccaggatcagcaaggctgtcatcccagcagccggtctcggtacc
cggttcctgccggccaccaaggccactcccaaggagatgctgccggtcgtcgacaagccg
gcgatccagtacgtggtcgaagaggccgtcaccgccggccttggcgacgtcctcatggtc
accggccgcaacaagcgccccctcgaggaccacttcgaccgcaattacgaactggagtcc
gccctccagaagaagggcgacgcgagccgcctggccaaggtccaggaatccagcgacctc
gcgatgatgcactacgtccgccagggcgaccccaagggcctcggccacgccgtgctgtgc
gccgccccgcacgtcggccacgagcccttcgcggtcctgctcggcgacgacctgatcgac
ccgcgcgaccccctgctccagcgcatgatcgacgtccaggagcagtacggcggcagcgtg
atcgccctcatggaggtcgcgccggagcagattcacctctacggctgcgcggccgtggag
agcaccgcggacagcgacgtggtcaaggtcggcggactggtcgagaagccggacccggcc
gacgccccgtccaactacgccatcatcggccgctacgtgctcgacccgcacgtcttcgac
atactccgcaagaccgagcccggccgcggcggcgagatccagctgaccgacgccctccag
caactcgccgaggacgagtccgtcggcggcccggtgcacggcgtcgtcttcaagggccgc
cgctatgacaccggcgaccgcggcgactacctgcgtgccattgtccgactcgcgtgcgaa
cgtgaggacctgggcccggacttccggacctggctccgcagttacgtagccgaggagatg
cagggacgttga

DBGET integrated database retrieval system