KEGG   Streptomyces coelicolor: SCO3185Help
Entry
SCO3185           CDS       T00085                                 

Gene name
cvrA, nhaP2, ycgO
Definition
(RefSeq) potassium/proton antiporter
  KO
K11105  cell volume regulation protein A
Organism
sco  Streptomyces coelicolor
Brite
Transporters [BR:sco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SCO3185 (cvrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_C
Motif
Other DBs
NCBI-GeneID: 1098619
NCBI-ProteinID: NP_627399
Kitasato: SCO3185
UniProt: Q9KYW0
Position
3491383..3492930
Genome map
AA seq 515 aa AA seqDB search
MRCARERERPLTVHHLNQLLLVCSLVLLIAVAAVRISSRSGLPSLLVYLAIGVAMGQDGI
GDIQFDNAELVQVIGYGALVVILAEGGLGTKWKEAKPALPAASALALGGVAVSVGVTAAG
AHYLTGLEWRQALIVGAVVSSTDAAAVFSVLRRIPLPKRITGTLEAESGFNDAPVVILVV
AFSTAGPIEHWYVLLGEIALELAIGAAIGLAVGWLGSWGLKHVALPASGLYPIAVMSIAI
AAYAAGAMAHGSGFLAVYLASMVMGNARLPHWPATRGFADGLGWLAQIGMFVLLGLLVTP
HELGDDILPALVIGLVLTMVARPLSVVLCLVPFRVPWQEQALMSWAGLRGAVPIILATIP
MVEGVAGSHRIFNIVFVLVVVYTLVQGPTLPWLARKLRLGKGDEAADLGIESAPLERLRG
HLLSVTIPEGSRMHGVEVNELRLPTGAAVTLVVRDGTSFVPLPTTGLRRGDELLVVATDP
VRDAAEARLRAVGHGGKLAGWLGTGGTEGARGNRR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcgccagggaaagggaacggccgctgactgtccaccacctcaaccagctcctg
ctcgtctgctcgctcgtcctgctcatcgccgtggcggcggtccggatctcctcgcgcagc
gggctccccagcctgctcgtctacctggccatcggcgtcgccatgggccaggacggcatc
ggcgacatccagttcgacaacgccgaactcgtccaggtcatcggctacggggccctggtc
gtgatcctggccgagggcggactcggcacgaagtggaaggaggcgaaaccggcgctcccg
gccgcctccgcgctggcgctgggcggcgtcgcggtgagcgtcggcgtgaccgcggcgggc
gcgcactacctcaccgggctggagtggcggcaggcactgatcgtcggggccgtggtctcc
tccacggacgccgcggccgtcttctccgtgctgcgccggattccgctgcccaagcggata
acgggcacgctggaggccgagtccggcttcaacgacgctccggtggtcatcctcgtggtc
gccttctccacggcgggaccgatcgagcactggtacgtgctcctcggcgagatcgccctg
gagctggccatcggcgcggccatcgggctcgcggtcggctggctcgggtcgtgggggctc
aagcacgtggcgctgcccgcctccggcctctaccccatcgccgtcatgtcgatcgccatc
gccgcctacgcggccggtgcgatggcccacggcagtggcttcctggccgtctacctcgcc
tcgatggtcatgggcaacgcgcggctgccgcactggcccgccacccggggcttcgccgac
gggctgggctggctcgcccagatcggcatgttcgtgctgctcggcctgctggtcaccccg
cacgagctgggcgacgacatcctgcccgccctggtcatcgggctggtgctcaccatggtg
gcgcgcccgctgagcgtcgtgctgtgcctggtgcccttccgggtgccgtggcaggagcag
gccctgatgtcctgggccgggctgcgcggcgcggtgcccatcatcctggcgacgatcccc
atggtggagggcgtcgcgggcagccaccgcatcttcaacatcgtcttcgtactggtcgtc
gtctacaccctggtgcagggcccgacgctgccgtggctggcccgcaagctgcgcctgggc
aagggcgacgaggcggccgacctcggcatcgagtcggcgcccctggaacggctgcgcggg
cacctgctgtccgtgacgatcccggagggttccaggatgcacggcgtcgaggtcaacgag
cttcggctgcccaccggggccgccgtcaccctggtcgtccgcgacgggacgtccttcgtg
ccgctgccgaccacggggctgcgccgcggcgacgagctcctggtggtcgccacggacccc
gtgcgggacgccgccgaggcgcggctgcgcgcggtcggccacggcggcaagctggccggc
tggctcggcaccgggggcaccgagggcgcccgcggcaatcgcaggtga

DBGET integrated database retrieval system